keyword
MENU ▼
Read by QxMD icon Read
search

systemic infection

keyword
https://www.readbyqxmd.com/read/29145348/magnusiomyces-capitatus-peritonitis-in-a-child-with-acute-lymphocytic-leukemia-as-a-breakthrough-infection-during-caspofungin-therapy
#1
Ayşe Bariş, Haşim Gencer, Nazan Dalgiç, Güntülü Şik, Fatma Özakkaş, Elif Aktaş
Magnusiomyces capitatus is an emerging opportunistic fungal pathogen particularly in immunocompromised patients. We report a case of a M. capitatus peritonitis in child with acute lymphocytic leukemia as a breakthrough infection during caspofungin therapy. The possibility of breakthrough infections caused by M. capitatus must be taken into consideration, particularly in immunosupressed patients being treated for systemic fungal infections by caspofungin. Although there are no defined breakpoints for susceptibility testing of M...
December 2017: Pediatric Infectious Disease Journal
https://www.readbyqxmd.com/read/29145159/potential-link-between-m-6-a-modification-and-systemic-lupus-erythematosus
#2
REVIEW
Lian-Ju Li, Yin-Guang Fan, Rui-Xue Leng, Hai-Feng Pan, Dong-Qing Ye
The field of m(6)A modification and epitranscriptomics has recently attracted much attention. More methods allowing for precise m(6)A site profiling and location are developed and crucial players of m(6)A modification machinery are increasingly identified. Although some challenges remain, m(6)A modification is found to modulate almost all aspects of RNA metabolism, such as splicing, stability, structure, translation, and export. Thus, m(6)A modification adds a new layer of post-transcriptional gene expression regulation, and it is implicated in T cell response to HIV infection, type I interferon production, and T cell differentiation and homeostasis...
November 13, 2017: Molecular Immunology
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#3
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29144452/ubiquitination-and-degradation-of-gbps-by-a-shigella-effector-to-suppress-host-defence
#4
Peng Li, Wei Jiang, Qin Yu, Wang Liu, Ping Zhou, Jun Li, Junjie Xu, Bo Xu, Fengchao Wang, Feng Shao
Interferon-inducible guanylate-binding proteins (GBPs) mediate cell-autonomous antimicrobial defences. Shigella flexneri, a Gram-negative cytoplasmic free-living bacterium that causes bacillary dysentery, encodes a repertoire of highly similar type III secretion system effectors called invasion plasmid antigen Hs (IpaHs). IpaHs represent a large family of bacterial ubiquitin-ligases, but their function is poorly understood. Here we show that S. flexneri infection induces rapid proteasomal degradation of human guanylate binding protein-1 (hGBP1)...
November 16, 2017: Nature
https://www.readbyqxmd.com/read/29144398/predict-the-relationship-between-gene-and-large-yellow-croaker-s-economic-traits
#5
Xiangxiang Zeng, Shuting Jin, Jin Jiang, Kunhuang Han, Xiaoping Min, Xiangrong Liu
The importance of a gene's impact on traits is well appreciated. Gene expression will affect the growth, immunity, reproduction and environmental resistance of some fish, and then affect the economic performance of fish-related business. Studying the connection between gene and character can help elucidate the growth of fishes. Thus far, a collected database containing large yellow croaker (Larimichthys crocea) genes does not exist. The gene having to do with the growth efficiency of fish will have a huge impact on research...
November 16, 2017: Molecules: a Journal of Synthetic Chemistry and Natural Product Chemistry
https://www.readbyqxmd.com/read/29144223/no-touch-disinfection-methods-to-decrease-multidrug-resistant-organism-infections-a-systematic-review-and-meta-analysis
#6
Alexandre R Marra, Marin L Schweizer, Michael B Edmond
BACKGROUND Recent studies have shown that using no-touch disinfection technologies (ie, ultraviolet light [UVL] or hydrogen peroxide vapor [HPV] systems) can limit the transmission of nosocomial pathogens and prevent healthcare-associated infections (HAIs). To investigate these findings further, we performed a systematic literature review and meta-analysis on the impact of no-touch disinfection methods to decrease HAIs. METHODS We searched PubMed, CINAHL, CDSR, DARE and EMBASE through April 2017 for studies evaluating no-touch disinfection technology and the nosocomial infection rates for Clostridium difficile, methicillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant enterococci (VRE), and other multidrug-resistant organisms (MDROs)...
November 16, 2017: Infection Control and Hospital Epidemiology
https://www.readbyqxmd.com/read/29144205/lessons-in-effector-and-nlr-biology-of-plant-microbe-systems
#7
Aleksandra Białas, Erin K Zess, Juan Carlos De la Concepcion, Marina Franceschetti, Helen G Pennington, Kentaro Yoshida, Jessica L Upson, Emilie Chanclud, Chih-Hang Wu, Thorsten Langner, Abbas Maqbool, Freya A Varden, Lida Derevnina, Khaoula Belhaj, Koki Fujisaki, Hiromasa Saitoh, Ryohei Terauchi, Mark J Banfield, Sophien Kamoun
A diversity of plant-associated organisms secrete effectors-proteins and metabolites that modulate plant physiology to favor host infection and colonization. However, effectors can also activate plant immune receptors, notably nucleotide-binding domain and leucine-rich repeat region (NLR)-containing proteins, enabling plants to fight off invading organisms. This interplay between effectors, their host targets, and the matching immune receptors is shaped by intricate molecular mechanisms and exceptionally dynamic coevolution...
November 16, 2017: Molecular Plant-microbe Interactions: MPMI
https://www.readbyqxmd.com/read/29144204/specific-hypersensitive-response-associated-recognition-of-new-apoplastic-effectors-from-cladosporium-fulvum-in-wild-tomato
#8
Carl H Mesarich, Bilal Ӧkmen, Hanna Rovenich, Scott A Griffiths, Changchun Wang, Mansoor Karimi Jashni, Aleksandar Mihajlovski, Jérôme Collemare, Lukas Hunziker, Cecilia H Deng, Ate van der Burgt, Henriek G Beenen, Matthew D Templeton, Rosie E Bradshaw, Pierre J G M de Wit
Tomato leaf mold disease is caused by the biotrophic fungus Cladosporium fulvum. During infection, C. fulvum produces extracellular small secreted protein (SSP) effectors that function to promote colonization of the leaf apoplast. Resistance to the disease is governed by Cf immune receptor genes that encode receptor-like proteins (RLPs). These RLPs recognize specific SSP effectors to initiate a hypersensitive response (HR) that renders the pathogen avirulent. C. fulvum strains capable of overcoming one or more of all cloned Cf genes have now emerged...
November 16, 2017: Molecular Plant-microbe Interactions: MPMI
https://www.readbyqxmd.com/read/29143896/modulation-of-stimulator-of-interferon-genes-sting-expression-by-interferon-%C3%AE-in-human-keratinocytes
#9
Yohei Nishikawa, Yasushi Matsuzaki, Kazuyuki Kimura, Akiko Rokunohe, Hajime Nakano, Daisuke Sawamura
Infection of microbial pathogen triggers the innate immune system, and the induction of interferons (IFNs) play a vital role in host antiviral response. Stimulator of interferon genes (STING) was identified as a crucial regulator of the DNA sensing pathway, and activates both nuclear factor-κB and interferon regulatory factor 3 transcription pathways to evoke IFNs production. In this study, we studied the upregulation of STING mRNA expression, induced by IFN-γ in human keratinocytes (HaCaT). STING promoter assays clarified that a gamma-activated sequence (GAS), located at - 7 to - 15-bp, is required for IFN-γ-upregulated promoter activity...
November 16, 2017: Biochemical Genetics
https://www.readbyqxmd.com/read/29143810/next-generation-pacemakers-from-small-devices-to-biological-pacemakers
#10
REVIEW
Eugenio Cingolani, Joshua I Goldhaber, Eduardo Marbán
Electrogenesis in the heart begins in the sinoatrial node and proceeds down the conduction system to originate the heartbeat. Conduction system disorders lead to slow heart rates that are insufficient to support the circulation, necessitating implantation of electronic pacemakers. The typical electronic pacemaker consists of a subcutaneous generator and battery module attached to one or more endocardial leads. New leadless pacemakers can be implanted directly into the right ventricular apex, providing single-chamber pacing without a subcutaneous generator...
November 16, 2017: Nature Reviews. Cardiology
https://www.readbyqxmd.com/read/29143683/the-progression-of-heartworm-associated-respiratory-disease-hard-in-spf-cats-18%C3%A2-months-after-dirofilaria-immitis-infection
#11
A Ray Dillon, Bryon L Blagburn, Michael Tillson, William Brawner, Betsy Welles, Calvin Johnson, Russell Cattley, Pat Rynders, Sharron Barney
BACKGROUND: Heartworm-associated respiratory disease (HARD) in cats is induced by the arrival and death of immature adult Dirofilaria immitis in the pulmonary system and is indistinguishable from mature adult heartworm infection. METHODS: A controlled, blind research study investigated the long-term (18 months post infection, PI) consequences of the inflammatory response associated with the death of immature adult heartworms in cats. Three groups of cats, 10 per group, were infected with 100 third-stage (L3) larvae by subcutaneous injection...
November 9, 2017: Parasites & Vectors
https://www.readbyqxmd.com/read/29143676/the-future-of-viral-hepatitis-testing-innovations-in-testing-technologies-and-approaches
#12
REVIEW
Rosanna W Peeling, Debrah I Boeras, Francesco Marinucci, Philippa Easterbrook
A large burden of undiagnosed hepatitis virus cases remains globally. Despite the 257 million people living with chronic hepatitis B virus infection, and 71 million with chronic viraemic HCV infection, most people with hepatitis remain unaware of their infection. Advances in rapid detection technology have created new opportunities for enhancing access to testing and care, as well as monitoring of treatment. This article examines a range of other technological innovations that can be leveraged to provide more affordable and simplified approaches to testing for HBV and HCV infection and monitoring of treatment response...
November 1, 2017: BMC Infectious Diseases
https://www.readbyqxmd.com/read/29143659/effect-of-heartworm-disease-and-heartworm-associated-respiratory-disease-hard-on-the-right-ventricle-of-cats
#13
Randolph L Winter, A Ray Dillon, Russell C Cattley, Byron L Blagburn, D Michael Tillson, Calvin M Johnson, William R Brawner, Elizabeth G Welles, Sharon Barney
BACKGROUND: Dirofilaria immitis infection occurs in dogs and cats, both of which species are clinically affected by mature adult infections. Cats are uniquely affected by immature-adult infections with an inflammatory pulmonary disease called Heartworm-Associated Respiratory Disease (HARD). D. immitis infection causes pulmonary parenchymal and vascular pathology in the dog and cat. Dogs develop pulmonary hypertension and cor pulmonale, whereas the development of pulmonary hypertension is rare in the cat...
November 9, 2017: Parasites & Vectors
https://www.readbyqxmd.com/read/29143089/surgical-treatment-of-gastro-pulmonary-fistula-following-bariatric-surgery-possible-and-safe
#14
Alon Ben Nun, David Simansky, Merav Rokah, Nona Zeitlin, Nir Golan, Ramez Abu Khalil, Michalle Soudack
BACKGROUND: Laparoscopic sleeve gastrectomy is a common surgical management of morbid obesity. Major complication rate is 3-8%. Staple line leak is one of the most serious complications. In a small group of patients, a gastro-pulmonary fistula is formed. Endoscopic and minimally invasive measures are the first line of treatment with considerable success rate. There are very poor data in the literature what should be done in cases of failure. In this paper, we report our positive experience with definitive surgical repair...
November 15, 2017: World Journal of Surgery
https://www.readbyqxmd.com/read/29143081/generation-in-yeast-and-antigenic-characterization-of-hepatitis-e-virus-capsid-protein-virus-like-particles
#15
Martynas Simanavicius, Paulius Lukas Tamosiunas, Rasa Petraityte-Burneikiene, Reimar Johne, Rainer G Ulrich, Aurelija Zvirbliene, Indre Kucinskaite-Kodze
Hepatitis E is a globally distributed human disease caused by hepatitis E virus (HEV). In Europe, it spreads through undercooked pork meat or other products and with blood components through transfusions. There are no approved or golden standard serologic systems for HEV diagnostics. Commercially available HEV tests often provide inconsistent results which may differ among the assays. In this study, we describe generation in yeast and characterization of HEV genotype 3 (HEV-3) and rat HEV capsid proteins self-assembled into virus-like particles (VLPs) and the development of HEV-specific monoclonal antibodies (MAbs)...
November 15, 2017: Applied Microbiology and Biotechnology
https://www.readbyqxmd.com/read/29143062/-intracranial-cystic-lesions
#16
REVIEW
F Ahlhelm, K Shariat, S Götschi, S Ulmer
CLINICAL PROBLEM: Intracerebral cysts are common findings in imaging of the neurocranium and are not always clinically significant. The pathological spectrum of intracerebral cysts is, however, very broad and in addition to incidental findings includes developmental disorders, malformation tumors, primary and secondary neoplasms and infectious etiologies, such as cerebral abscess formation, cysticercosis or residuals after congenital cytomegalovirus infections. Intracerebral cystic defects may be caused by inflammatory central nervous system (CNS) diseases, such as multiple sclerosis as well as by mitochondriopathies, leukodystrophy, electrolyte disturbances or osmotic demyelination syndrome or brain infarctions, e...
November 15, 2017: Der Radiologe
https://www.readbyqxmd.com/read/29142880/comparison-of-apical-extrusion-of-intracanal-bacteria-by-various-glide-path-establishing-systems-an-in-vitro-study
#17
Alberto Dagna, Rashid El Abed, Sameeha Hussain, Ibrahim H Abu-Tahun, Livia Visai, Federico Bertoglio, Floriana Bosco, Riccardo Beltrami, Claudio Poggio, Hyeon-Cheol Kim
Objectives: This study compared the amount of apically extruded bacteria during the glide-path preparation by using multi-file and single-file glide-path establishing nickel-titanium (NiTi) rotary systems. Materials and Methods: Sixty mandibular first molar teeth were used to prepare the test apparatus. They were decoronated, blocked into glass vials, sterilized in ethylene oxide gas, infected with a pure culture of Enterococcus faecalis, randomly assigned to 5 experimental groups, and then prepared using manual stainless-steel files (group KF) and glide-path establishing NiTi rotary files (group PF with PathFiles, group GF with G-Files, group PG with ProGlider, and group OG with One G)...
November 2017: Restorative Dentistry & Endodontics
https://www.readbyqxmd.com/read/29142746/interaction-between-merkel-cell-carcinoma-and-the-immune-system-pathogenetic-and-therapeutic-implications
#18
Irene Zanetti, Ilaria Coati, Mauro Alaibac
Merkel cell carcinoma (MCC) is a rare, aggressive primary cutaneous neuroendocrine carcinoma. It usually appears on the face and neck of elderly Caucasian people as a flesh-colored, erythematous or violaceous dome-shaped, non-tender nodule with a smooth surface. In immunocompromised patients with T-cell dysfunction, such as patients with acquired immunodeficiency syndrome (AIDS) or solid organ transplant recipients, the incidence of this disease is markedly increased. This suggests a link between the development of MCC and the immune system...
November 2017: Molecular and Clinical Oncology
https://www.readbyqxmd.com/read/29142539/values-of-magnetic-resonance-imaging-and-cerebrospinal-fluid-analysis-in-the-diagnosis-of-central-nervous-system-associated-infectious-diseases
#19
Dongfeng Zhang
Objective: To discuss the roles of magnetic resonance imaging (MRI) and cerebrospinal fluid analysis in the identification of central nervous system associated infection and provide a reference for the diagnosis and treatment of central nervous system associated infectious diseases. Methods: Seventy-six patients who developed central nervous system infection and were admitted into the Henan People's Hospital between June 2014 and October 2015 were randomly selected as an observation group...
September 2017: Pakistan Journal of Medical Sciences Quarterly
https://www.readbyqxmd.com/read/29142443/oral-health-and-erectile-dysfunction
#20
REVIEW
Vijendra P Singh, Sunil K Nettemu, Sowmya Nettem, Rajesh Hosadurga, Sangeeta U Nayak
Ample evidence strongly supports the fact that periodontal disease is a major risk factor for various systemic diseases namely cardio-vascular disease, diabetes mellitus, etc. Recently, investigators focussed on exploring the link between chronic periodontitis (CP) and erectile dysfunction (ED) by contributing to the endothelial dysfunction. Both the diseases share common risk factors. Various studies conducted in different parts of the world in recent years reported the evidence linking this relationship as well as improvement in ED with periodontal treatment...
July 2017: Journal of Human Reproductive Sciences
keyword
keyword
99872
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"