keyword
MENU ▼
Read by QxMD icon Read
search

artur

keyword
https://www.readbyqxmd.com/read/29166481/-prep-forum-an-on-line-debate-on-pre-exposure-prophylaxis-in-brazil
#1
Artur Acelino Francisco Luz Nunes Queiroz, Alvaro Francisco Lopes de Sousa
This study aimed to identify health-promoting contents focused on HIV/Aids prevention in messages posted in a Facebook group for debates on the use of pre-exposure prophylaxis (PrEP). This was a prospective observational study using systematic non-participant observation. From July 2015 to June 2016, all the posts in the group were catalogued and formed a corpus. Everything was processed in IRaMuTeQ and analyzed by descending hierarchical classification. The collected data were grouped in three classes: (1) HIV/Aids prevention: discussing prophylaxis, treatment, target public, and side effects; (2) universal access to PrEP in Brazil: discussing government responsibilities; (3) on-line purchase of truvada: exposing a situation of vulnerability...
November 21, 2017: Cadernos de Saúde Pública
https://www.readbyqxmd.com/read/29165982/phosphor-assisted-temperature-sensing-and-imaging-using-resonant-and-non-resonant-photoexcitation-scheme
#2
Artur Bednarkiewicz, Karolina Trejgis, Joanna Drabik, Agnieszka Kowalczyk, Lukasz Marciniak
Phosphor Assisted Luminescent Thermometry relays on studying, often subtle, temperature dependent spectral properties, such as luminescence spectra, bands shifts or luminescence lifetimes. While this is feasible with high resolution spectrometers or time resolved detectors, technical implementation of such temperature mapping or wide field imaging is complex and cumbersome. Therefore, new approach for non-contact ratiometric temperature detection has been proposed based on comparison of emission properties of bright Cr3+ doped phosphors at single emission band upon two, resonant and non-resonant optical excitation bands...
November 22, 2017: ACS Applied Materials & Interfaces
https://www.readbyqxmd.com/read/29165343/auxeticity-of-yukawa-systems-with-nanolayers-in-the-111-crystallographic-plane
#3
Paweł M Pigłowski, Jakub W Narojczyk, Artur A Poźniak, Krzysztof W Wojciechowski, Konstantin V Tretiakov
Elastic properties of model crystalline systems, in which the particles interact via the hard potential (infinite when any particles overlap and zero otherwise) and the hard-core repulsive Yukawa interaction, were determined by Monte Carlo simulations. The influence of structural modifications, in the form of periodic nanolayers being perpendicular to the crystallographic axis [111], on auxetic properties of the crystal was investigated. It has been shown that the hard sphere nanolayers introduced into Yukawa crystals allow one to control the elastic properties of the system...
November 22, 2017: Materials
https://www.readbyqxmd.com/read/29164673/reviewing-and-addressing-the-link-between-mass-media-and-the-increase-in%C3%A2-obesity-among-european-children-the-european-academy-of-paediatrics-eap-and-the-european-childhood-obesity-group-ecog-consensus-statement
#4
Artur Mazur, Margherita Caroli, Igor Radziewicz-Winnicki, Paulina Nowicka, Daniel Weghuber, David Neubauer, Łukasz Dembiński, Francis P Crawley, Martin White, Adamos Hadjipanayis
This study reviewed the link between social media and the growing epidemic of childhood obesity in Europe. A task force from the European Academy of Paediatrics and the European Childhood Obesity Group searched published literature and developed a consensus statement. It found that there was evidence of a strong link between obesity levels across European countries and childhood media exposure and that parents and society needed a better understanding of the influence of social media on dietary habits. CONCLUSION: Health policies in Europe must take account of the range of social media influences that promote the development of childhood obesity...
November 22, 2017: Acta Paediatrica
https://www.readbyqxmd.com/read/29163963/capsule-endoscopy-in-young-patients-with-iron-deficiency-anaemia-and-negative-bidirectional-gastrointestinal-endoscopy
#5
Diana E Yung, Emanuele Rondonotti, Andry Giannakou, Tomer Avni, Bruno Rosa, Ervin Toth, Alfredo J Lucendo, Reena Sidhu, Hanneke Beaumont, Pierre Ellul, Lucian Negreanu, Victoria Alejandra Jiménez-Garcia, Deidre McNamara, Uri Kopylov, Luca Elli, Konstantinos Triantafyllou, Fahmi Shibli, Maria Elena Riccioni, Mauro Bruno, Xavier Dray, John N Plevris, A Koulaouzidis, Federico Argüelles-Arias, Aymeric Becq, Federica Branchi, María Ángeles Tejero-Bustos, Jose Cotter, Rami Eliakim, Francesca Ferretti, Ian M Gralnek, Juan Manuel Herrerias-Gutierrez, Mary Hussey, Maarten Jacobs, Gabriele Wurm Johansson, Mark McAlindon, Sara Montiero, Artur Nemeth, Marco Pennazio, Deepa Rattehalli, Ana Stemate, Annalisa Tortora, Georgios Tziatzios
Background: Recent data imply young patients (age ≤50 years) undergoing small-bowel (SB) capsule endoscopy (CE) for iron deficiency anaemia (IDA) show higher diagnostic yield (DY) for sinister pathology. We aimed to investigate DY of CE in a large cohort of young IDA patients, and evaluate factors predicting significant SB pathology. Materials and methods: This was a retrospective, multicentre study (2010-2015) in consecutive, young patients (≤50 years) from 18 centres/12 countries, with negative bidirectional gastrointestinal (GI) endoscopy undergoing SBCE for IDA...
November 2017: United European Gastroenterology Journal
https://www.readbyqxmd.com/read/29162522/loss-of-consciousness-is-related-to-hyper-correlated-gamma-band-activity-in-anesthetized-macaques-and-sleeping-humans
#6
Michał Bola, Adam B Barrett, Andrea Pigorini, Lino Nobili, Anil K Seth, Artur Marchewka
Loss of consciousness can result from a wide range of causes, including natural sleep and pharmacologically induced anesthesia. Important insights might thus come from identifying neuronal mechanisms of loss and re-emergence of consciousness independent of a specific manipulation. Therefore, to seek neuronal signatures of loss of consciousness common to sleep and anesthesia we analyzed spontaneous electrophysiological activity recorded in two experiments. First, electrocorticography (ECoG) acquired from 4 macaque monkeys anesthetized with different anesthetic agents (ketamine, medetomidine, propofol) and, second, stereo-electroencephalography (sEEG) from 10 epilepsy patients in different wake-sleep stages (wakefulness, NREM, REM)...
November 18, 2017: NeuroImage
https://www.readbyqxmd.com/read/29161526/individualism-collectivism-social-self-control-and-adolescent-substance-use-and-risky-sexual-behavior
#7
Pallav Pokhrel, Brooke L Bennett, Sakshi Regmi, Bulat Idrisov, Artur Galimov, Leila Akhmadeeva, Steve Sussman
Individualism and collectivism are cultural syndromes that have been associated with adolescent problem behavior in studies conducted in the U.S. and Southeast Asia. However, research investigating the mechanisms of how cultural orientation impacts health risk behaviors has been limited. This study tested a new model explaining the relationship between cultural orientation (i.e., individualism, collectivism) and adolescent problem behavior (i.e., substance use and risky sex) in terms of interpersonal self-regulation (i...
November 21, 2017: Substance Use & Misuse
https://www.readbyqxmd.com/read/29161217/use-of-vascular-closure-devices-for-endovascular-interventions-requiring-a-direct-puncture-of-pete-grafts
#8
Artur I Milnerowicz, Aleksandra A Milnerowicz, Marcin Protasiewicz, Wiktor Kuliczkowski
BACKGROUND: Effectiveness of vascular closure devices during endovascular procedures requiring a direct puncture of a vascular prosthesis placed in the inguinal region is unknown. PATIENTS AND METHODS: The retrospective analysis included 134 patients with a history of polyethylene terephthalate (PETE) graft implantation in the inguinal region. In 20 (15 %) patients, haemostasis was achieved with manual compression, in 21 (16 %) with the StarClose™, and in 93 (69 %) with the AngioSeal™ device...
November 21, 2017: VASA. Zeitschrift Für Gefässkrankheiten
https://www.readbyqxmd.com/read/29160420/next-generation-sequencing-based-genomic-profiling-fostering-innovation-in-cancer-care
#9
Gustavo S Fernandes, Daniel F Marques, Daniel M Girardi, Maria Ignez F Braghiroli, Renata A Coudry, Sibele I Meireles, Artur Katz, Paulo M Hoff
OBJECTIVES: With the development of next-generation sequencing (NGS) technologies, DNA sequencing has been increasingly utilized in clinical practice. Our goal was to investigate the impact of genomic evaluation on treatment decisions for heavily pretreated patients with metastatic cancer. METHODS: We analyzed metastatic cancer patients from a single institution whose cancers had progressed after all available standard-of-care therapies and whose tumors underwent next-generation sequencing analysis...
October 2017: Clinics
https://www.readbyqxmd.com/read/29158507/dynamically-controlled-purcell-enhancement-of-visible-spontaneous-emission-in-a-gated-plasmonic-heterostructure
#10
Yu-Jung Lu, Ruzan Sokhoyan, Wen-Hui Cheng, Ghazaleh Kafaie Shirmanesh, Artur R Davoyan, Ragip A Pala, Krishnan Thyagarajan, Harry A Atwater
Emission control of colloidal quantum dots (QDs) is a cornerstone of modern high-quality lighting and display technologies. Dynamic emission control of colloidal QDs in an optoelectronic device is usually achieved by changing the optical pump intensity or injection current density. Here we propose and demonstrate a distinctly different mechanism for the temporal modulation of QD emission intensity at constant optical pumping rate. Our mechanism is based on the electrically controlled modulation of the local density of optical states (LDOS) at the position of the QDs, resulting in the modulation of the QD spontaneous emission rate, far-field emission intensity, and quantum yield...
November 21, 2017: Nature Communications
https://www.readbyqxmd.com/read/29156374/genetic-profiling-and-surface-proteome-analysis-of-human-atrial-stromal-cells-and-rat-ventricular-epicardium-derived-cells-reveals-novel-insights-into-their-cardiogenic-potential
#11
Sebastian Temme, Daniela Friebe, Timo Schmidt, Gereon Poschmann, Julia Hesse, Bodo Steckel, Kai Stühler, Meik Kunz, Thomas Dandekar, Zhaoping Ding, Payam Akhyari, Artur Lichtenberg, Jürgen Schrader
Epicardium-derived cells (EPDC) and atrial stromal cells (ASC) display cardio-regenerative potential, but the molecular details are still unexplored. Signals which induce activation, migration and differentiation of these cells are largely unknown. Here we have isolated rat ventricular EPDC and rat/human ASC and performed genetic and proteomic profiling. EPDC and ASC expressed epicardial/mesenchymal markers (WT-1, Tbx18, CD73, CD90, CD44, CD105), cardiac markers (Gata4, Tbx5, troponin T) and also contained phosphocreatine...
November 7, 2017: Stem Cell Research
https://www.readbyqxmd.com/read/29155201/biochemical-properties-of-the-htra-homolog-from-bacterium-stenotrophomonas-maltophilia
#12
Urszula Zarzecka, Anna Modrak-Wojcik, Martyna Bayassi, Maciej Szewczyk, Artur Gieldon, Adam Lesner, Tomasz Koper, Agnieszka Bzowska, Maurizio Sanguinetti, Steffen Backert, Barbara Lipinska, Joanna Skorko-Glonek
The HtrA proteins due to their proteolytic, and in many cases chaperone activity, efficiently counteract consequences of stressful conditions. In the environmental bacterium and nosocomial pathogen Stenotrophomonas maltophilia HtrA (HtrASm) is induced as a part of adaptive response to host temperature (37°C). We examined the biochemical properties of HtrASm and compared them with those of model HtrAEc from Escherichia coli. We found that HtrASm is a protease and chaperone that operates over a wide range of pH and is highly active at temperatures between 35-37°C...
November 16, 2017: International Journal of Biological Macromolecules
https://www.readbyqxmd.com/read/29154238/ctrc-gene-polymorphism-may-increase-pancreatic-cancer-risk-preliminary-study
#13
Stanisław Głuszek, Artur Kowalik, Dorota Kozieł, Iwona Wawrzycka, Martyna Głuszek-Osuch, Jarosław Matykiewicz
Pancreatic cancer is often fatal due to delayed diagnosis and treatment difficulties. OBJECTIVE: To analyze selected SPINK1, CTRC, CFTR, and PRSS1 gene mutations in cancer tissue and blood samples of patients with pancreatic tumors. MATERIALS AND METHOD: We enrolled 16 consecutive patients diagnosed with pancreatic tumors. We collected cancer tissue, normal pancreatic tissue, and blood samples for genetic tests. The control group consisted of 419 healthy individuals...
October 31, 2017: Polski Przeglad Chirurgiczny
https://www.readbyqxmd.com/read/29151156/deep-rnaseq-indicates-protective-mechanisms-of-cold-tolerant-indica-rice-plants-during-early-vegetative-stage
#14
Raul Antonio Sperotto, Artur Teixeira de Araújo Junior, Janete Mariza Adamski, Denise Cargnelutti, Felipe Klein Ricachenevsky, Ben-Hur Neves de Oliveira, Renata Pereira da Cruz, Rinaldo Pires Dos Santos, Leila Picolli da Silva, Janette Palma Fett
Cold-tolerance in rice may be related to increased cellulose deposition in the cell wall, membrane fatty acids unsaturation and differential expression of several newly identified genes. Low temperature exposure during early vegetative stages limits rice plant's growth and development. Most genes previously related to cold tolerance in rice are from the japonica subspecies. To help clarify the mechanisms that regulate cold tolerance in young indica rice plants, comparative transcriptome analysis of 6 h cold-treated (10 °C) leaves from two genotypes, cold-tolerant (CT) and cold-sensitive (CS), was performed...
November 18, 2017: Plant Cell Reports
https://www.readbyqxmd.com/read/29147651/prevalence-and-relevance-of-pruritus-in-pregnancy
#15
Justyna Szczęch, Artur Wiatrowski, Lidia Hirnle, Adam Reich
Pregnant women are at greater risk to suffer from chronic pruritus, but data on this symptom in this group is very limited. The aim of this study was to investigate the prevalence, clinical characteristics, and the importance of pruritus in pregnant women. A total of 292 consecutive pregnant women at the 33.0 ± 6.1 weeks of gestation (WoG) were recruited into this prospective, cross-sectional study. All patients underwent thorough anamnesis and detailed physical examination with the special emphasis on pruritus...
2017: BioMed Research International
https://www.readbyqxmd.com/read/29145635/trex-a-web-portal-for-exploration-of-trna-derived-fragments-in-arabidopsis-thaliana
#16
Agnieszka Thompson, Andrzej Zielezinski, Patrycja Plewka, Maciej Szymanski, Przemyslaw Nuc, Zofia Szweykowska-Kulinska, Artur Jarmolowski, Wojciech M Karlowski
tRNA-derived fragments (tRFs) constitute a new class of short regulatory RNAs that are a product of nascent or mature tRNA processing. tRF sequences have been identified in all domains of life; however, most published research pertains to human, yeast and some bacterial organisms. Despite growing interest in plant tRFs and accumulating evidence of their function in plant development and stress responses, no public, web-based repository dedicated to these molecules is currently available. Here, we introduce tRex (http://combio...
November 14, 2017: Plant & Cell Physiology
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#17
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29144024/epidemiology-of-type-1-diabetes-in-polish-children-a-multicentre-cohort-study
#18
Mieczysław Szalecki, Marta Wysocka-Mincewicz, Anna Ramotowska, Artur Mazur, Lucyna Lisowicz, Iwona Ben-Skowronek, Joanna Sieniawska, Bożena Klonowska, Dorota Charemska, Jolanta Nawrotek, Irena Jałowiec, Artur Bossowski, Milena Jamiołkowska, Beata Pyrżak, Grażyna Miszkurka, Agnieszka Szypowska
BACKGROUND: The incidence of childhood Type-1 diabetes (T1D) varies greatly between populations and the estimates and/or predictions of the rates would aid in adequate planning of health care resources. The study's aim was to assess the incidence of T1D in the paediatric population of eastern and central Poland. METHODS: In this cohort study covering the period from January 2010 to December 2014 data were collected for children and adolescents below 18 years of age with newly diagnosed T1D, living in eastern and central Poland...
November 16, 2017: Diabetes/metabolism Research and Reviews
https://www.readbyqxmd.com/read/29142129/entry-of-human-coronavirus-nl63-to-the-cell
#19
Aleksandra Milewska, Paulina Nowak, Katarzyna Owczarek, Artur Szczepanski, Miroslaw Zarebski, Agnieszka Hoang-Bujnowicz, Krzysztof Berniak, Jacek Wojarski, Slawomir Zeglen, Zbigniew Baster, Zenon Rajfur, Krzysztof Pyrc
First steps of human coronavirus NL63 (HCoV-NL63) infection were previously described. The virus binds to target cells by heparan sulfate proteoglycans, and interacts with the ACE2 protein. Subsequent events, including virus internalization and trafficking, remain to be elucidated. In this study, we mapped the process of HCoV-NL63 entry into LLC-Mk2 cell line and ex vivo 3D tracheobronchial tissue.Using a variety of techniques we have shown that HCoV-NL63 virions require endocytosis for successful entry to the LLC-MK2 cells, and interaction between the virus and the ACE2 molecule triggers recruitment of clathrin...
November 15, 2017: Journal of Virology
https://www.readbyqxmd.com/read/29142039/risk-factors-associated-with-juvenile-idiopathic-arthritis-exposure-to-cigarette-smoke-and-air-pollution-from-pregnancy-to-disease-diagnosis
#20
Camila Maria Paiva França, Adriana Maluf Elias Sallum, Alfésio Luis Ferreira Braga, Fernando Louzada Strufaldi, Clovis Artur Almeida Silva, Sylvia Costa Lima Farhat
OBJECTIVE: To evaluate exposure to environmental factors inhaled during pregnancy and after birth until juvenile idiopathic arthritis (JIA) diagnosis among residents of a large city. METHODS: This is an exploratory case-control study that consists of 66 patients with JIA and 124 healthy controls matched by age and sex, living in the São Paulo, Brazil, metropolitan area until JIA diagnosis, and whose mothers had resided in this region during pregnancy. A structured and reliable questionnaire (κ index for test-retest was 0...
November 15, 2017: Journal of Rheumatology
keyword
keyword
96441
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"