Read by QxMD icon Read


Xiang Ren, Qihang Guo, Jianhui Chen, Hujun Xie, Qing Xu, Zhan Lu
The visible-light-promoted diastereodivergent intramolecular oxyamination of alkenes and amination of unactivated C(Sp3)-H bonds is described to construct oxazolindinones, pyrrolidinones and imidazolidones via mild generation of primary amidyl radicals from functionalized hydroxylamines. A unique phenomenon on highly diastereoselective ring-opening of aziridines controlled by electron sacrifices was observed. High diastereoselective amino alcohols derivatives were obtained efficiently through this protocol in gram scales...
October 22, 2016: Chemistry: a European Journal
N Didbaridze, N Lomidze, T Abuladze, G Qiliptari, T Didbaridze, I Gvasalia, Z Mkervalishvili, N Gogokhia
Anaerobic clostridial infection is the most severe form of paraproctitis. The incubation period is very short, from 3 to 6 hours, sometimes lasting for 1-2 days. Clostridial infection spreads rapidly and induces gas gangrene, causes destruction of cells and other intermediate substances, and impedes blood circulation. This paper presents a case study of an extremely severe form of anaerobic infection with spontaneous gas gangrene, cellulitis, fasciomyositic necrosis, severe intoxication and septic shock on the abdominal front and lateral surfaces...
September 2016: Georgian Medical News
T Koiava, D Gonçalves, J Palmeira, K Arobelidze, M Tediashvili, L Akhvlediani, H Ferreira
Research describing the epidemiology of antibiotic resistant microbes is vital to the proactive development of new antimicrobial agents. In the last years, CTX-M extended-spectrum β-lactamases (ESBLs) have emerged worldwide and have replaced classical TEM and SHV-type ESBLs in many countries. CTX-M-15 is currently the most frequent, with a pandemic distribution, and its rapid spread is facilitated by incorporation of resistance genes in mobile genetic elements. The ESBL is efficacious in Gram-negative bacteria and thus closely associated with nosocomial environments, often colonizing the intestines, particularly in older and dependent patients...
September 2016: Georgian Medical News
T Didbaridze, L Saginashvili, L Akhmeteli, B Iremashvili, N Gogokhia
This study provides a contemporary epidemiology of aspirates taken during surgery from the abdominal cavity among patients with bacterial peritonitis to identify the isolates and study their sensitivity to antibiotics. Our bacteriology investigations included isolation of poor cultures, and detection of microbes was conducted using a rapid identification system (API20E, API Staph, API Strep, API Ana, BioMerieux). Rapid tests for detection of oxidase and catalase activity were also used. Susceptibility of microorganisms to antibiotics was defined by the disc-diffusion method using standard discs (EUCAST guidelines 2015) according to Clinical Laboratory Standard Institute (CLSI) protocols (ATB strips: ATB G, ATB Staph, ATBANA, ATBPse, ATBStrep...
September 2016: Georgian Medical News
Yanfeng Zhang, Yong Xu, Wei Fang, Xiaotang Wang, Zemin Fang, Yazhong Xiao
A taxonomic study was carried out on a Gram-stain negative, rod-shaped, non-flagellated, and facultatively anaerobic bacterial strain designated as strain SF-16(T), which was isolated from an unidentified starfish in Sanya, China. Strain SF-16(T) was found to be 5.0-7.0 μm long, and oxidase and catalase positive. Cell growth was observed at pH 6.0-8.5 (optimum, 7.0-8.0), temperatures of 10-41 °C (optimum, 25-30 °C), and salinities of 0-12 % (optimum, 3.0-6.0 %). The predominant fatty acids (>20 %) were found to be C18:1 ω7c and/or C18:1 ω6c (summed feature 8)...
October 21, 2016: Antonie Van Leeuwenhoek
Yi Li, Xueqian Lei, Yanting Xu, Hong Zhu, Meiying Xu, Lijun Fu, Wei Zheng, Jinli Zhang, Tianling Zheng
A Gram-stain-negative, aerobic bacterial strain, designated Y21(T), was isolated from surface lake water in Xiamen, Fujian Province of China. Growth was observed at temperatures from 4 to 37 °C, at salinities from 0 to 7.0 % and at pH from 6.0 to 10.0. Optimum growth was observed at 28 °C, at pH 7.0 and with 1.5-2.0 % (w/v) NaCl. The highest similarity of 16S rRNA gene sequence between strain Y21(T) and the other strains was 96.9 %. Phylogenetic analysis based on 16S rRNA gene sequencing revealed that the strain was a member of the genus Rhizobium, forming a distinct lineage with R...
October 22, 2016: Current Microbiology
Jamie L Burgess, R Alan Burgess, Yalemi Morales, Jenna M Bouvang, Sean J Johnson, Nicholas E Dickenson
Like many Gram-negative pathogens, Shigella rely on a complex type three secretion system (T3SS) to inject effector proteins into host cells, take over host functions, and ultimately establish infection. Despite these critical roles, the energetics and regulatory mechanisms controlling the T3SS and pathogen virulence remain largely unclear. In this study, we present a series of high-resolution crystal structures of Spa47 and use the structures to model an activated Spa47 oligomer, finding that ATP hydrolysis may be supported by specific sidechain contributions from adjacent protomers within the complex...
October 21, 2016: Journal of Biological Chemistry
Héloïse Coté, Marie-Anne Boucher, André Pichette, Benoit Roger, Jean Legault
ETHNOPHARMACOLOGICAL RELEVANCE: Oleoresin of Abies balsamea (L.) Mill. was used by Aboriginal people of the boreal forest of Canada and French Canadians to treat various infections, suggesting that oleoresin has antibacterial properties. AIM OF THE STUDY: In this study, the antibacterial activity of whole oleoresin from A. balsamea was investigated against E. coli, S. aureus and two methicillin-resistant S. aureus (MRSA) strains using a new sensitive assay developed to evaluate hydrophobic matrix and compounds...
October 18, 2016: Journal of Ethnopharmacology
Kaouther Majouli, Assia Hamdi, Kamel Msaada, Abderraouf Kenani
This study was carried out with the objective to investigate the antibacterial activity of Hertia cheirifolia L. extracts against Gram-positive and Gram-negative strains including Staphylococcus aureus (ATCC 6538), Bacillus subtilis (ATCC 6633), Bacillus licheniformis, Esherichia coli (ATCC 8739), Pseudomonas aeruginosa (ATCC 9027), Salmonella enterica (CIP 8039) and Salmonella typhimirium. The results of this antibacterial screening showed that the ethyl acetate (EtOAc) extracts had the best activity against the tested microorganisms...
October 18, 2016: Microbial Pathogenesis
Florian Graef, Branko Vukosavljevic, Jean-Philippe Michel, Marius Wirth, Oliver Ries, Chiara De Rossi, Maike Windbergs, Véronique Rosilio, Christian Ducho, Sarah Gordon, Claus-Michael Lehr
Gram-negative bacteria possess a unique and complex cell envelope, composed of an inner and outer membrane separated by an intermediate cell wall-containing periplasm. This tripartite structure acts intrinsically as a significant biological barrier, often limiting the permeation of anti-infectives, and so preventing such drugs from reaching their target. Furthermore, identification of the specific permeation-limiting envelope component proves difficult in the case of many anti-infectives, due to the challenges associated with isolation of individual cell envelope structures in bacterial culture...
October 18, 2016: Journal of Controlled Release: Official Journal of the Controlled Release Society
J F Leal, I S Henriques, A Correia, E B H Santos, V I Esteves
Oxytetracycline (OTC) is one of the most used antibiotics in aquaculture. The main concern related to its use is the bacterial resistance, when ineffective treatments are applied for its removal or inactivation. OTC photo-degradation has been suggested as an efficient complementary process to conventional methods used in intensive fish production (e.g.: ozonation). Despite this, and knowing that the complete mineralization of OTC is difficult, few studies have examined the antibacterial activity of OTC photoproducts...
October 18, 2016: Environmental Pollution
Sanjib K Shrestha, Liliia M Kril, Keith D Green, Stefan Kwiatkowski, Vitaliy M Sviripa, Justin R Nickell, Linda P Dwoskin, David S Watt, Sylvie Garneau-Tsodikova
The emergence of multidrug-resistant bacterial and fungal strains poses a threat to human health that requires the design and synthesis of new classes of antimicrobial agents. We evaluated bis(N-amidinohydrazones) and N-(amidino)-N'-aryl-bishydrazones for their antibacterial and antifungal activities against panels of Gram-positive/Gram-negative bacteria as well as fungi. We investigated their potential to develop resistance against both bacteria and fungi by a multi-step resistance-selection method, explored their potential to induce the production of reactive oxygen species, and assessed their toxicity...
October 10, 2016: Bioorganic & Medicinal Chemistry
Naomi M Saville, Bhim P Shrestha, Sarah Style, Helen Harris-Fry, B James Beard, Aman Sengupta, Sonali Jha, Anjana Rai, Vikas Paudel, Anni-Maria Pulkki-Brannstrom, Andrew Copas, Jolene Skordis-Worrall, Bishnu Bhandari, Rishi Neupane, Joanna Morrison, Lu Gram, Raghbendra Sah, Machhindra Basnet, Jayne Harthan, Dharma S Manandhar, David Osrin, Anthony Costello
BACKGROUND: Low birth weight (LBW, < 2500 g) affects one third of newborn infants in rural south Asia and compromises child survival, infant growth, educational performance and economic prospects. We aimed to assess the impact on birth weight and weight-for-age Z-score in children aged 0-16 months of a nutrition Participatory Learning and Action behaviour change strategy (PLA) for pregnant women through women's groups, with or without unconditional transfers of food or cash to pregnant women in two districts of southern Nepal...
October 21, 2016: BMC Pregnancy and Childbirth
Jeremiah Seni, Enock Sweya, Amri Mabewa, Stephen E Mshana, Japhet M Gilyoma
BACKGROUND: Secondary peritonitis is a common surgical emergence with deadly outcomes when not timely and promptly intervened. The emergence of Extended spectrum beta lactamase producing bacteria (ESBL) poses treatment challenge at Bugando Medical Centre (BMC); hence a need to evaluate the magnitude of ESBL so as to guide specific therapy. METHODS: This was a cross sectional study conducted at BMC from May 2014 to April 2015 involving patients with secondary peritonitis...
October 21, 2016: BMC Emergency Medicine
Pradipta Ranjan Rauta, Sarbani Ashe, Debasis Nayak, Bismita Nayak
Virulence-related outer membrane proteins (Omps) are expressed in bacteria (Gram-negative) such as V. cholerae and are vital to bacterial invasion in to eukaryotic cell and survival within macrophages that could be best candidate for development of vaccine against V. cholerae. Applying in silico approaches, the 3-D model of the Omp was developed using Swiss model server and validated byProSA and Procheck web server. The continuous stretch of amino acid sequences 26mer: RTRSNSGLLTWGDKQTITLEYGDPAL and 31mer: FFAGGDNNLRGYGYKSISPQDASGALTGAKY having B-cell binding sites were selected from sequence alignment after B cell epitopes prediction by BCPred and AAP prediction modules of BCPreds...
October 12, 2016: Computational Biology and Chemistry
Troy A Skwor, Stephanie Klemm, Hanyu Zhang, Brianna Schardt, Stephanie Blaszczyk, Matthew A Bork
Increasing rates of antibiotic resistance coupled with the lack of novel antibiotics threatens proper clinical treatment and jeopardizes their use in prevention. A photodynamic approach appears to be an innovative treatment option, even for multi-drug resistant strains of bacteria. Three components are utilized in photodynamic inactivation: a photosensitizer, light source, and oxygen. Variations in photosensitizers strongly influence microbial binding and bactericidal activity. In this study, four different cationic metalloporphyrins (Cu(2+), Fe(2+), Pd(2+), Zn(2+)) were compared to the free-base ligand 5,10,15,20-tetrakis(N-methylpyridinium-4-yl)porphyrin regarding their electronic properties and generation of reactive oxygen species upon subsequent 405nm violet-blue irradiation...
October 15, 2016: Journal of Photochemistry and Photobiology. B, Biology
Narges Abdali, Jerry Matthew Parks, Keith Haynes, Julie L Chaney, Adam T Green, David Wolloscheck, John K Walker, Valentin V Rybenkov, Jerome Yves Baudry, Jeremy C Smith, Helen I Zgurskaya
Antibiotic resistance is a major threat to human welfare. Inhibitors of multidrug efflux pumps (EPIs) are promising alternative therapeutics that could revive activities of antibiotics and reduce bacterial virulence. Identification of new druggable sites for inhibition is critical for development of effective EPIs, especially in light of constantly emerging resistance. Here, we describe EPIs that interact with periplasmic membrane fusion proteins, critical components of efflux pumps that are responsible for the activation of the transporter and the recruitment of the outer-membrane channel...
October 21, 2016: ACS Infectious Diseases
Marta Gibert, Sonia Paytubi, Sergi Beltrán, Antonio Juárez, Carlos Balsalobre, Cristina Madrid
Plasmids of the incompatibility group HI1 (IncHI1) have been isolated from several Gram-negative pathogens and are associated with the spread of multidrug resistance. Their conjugation is tightly regulated and it is inhibited at temperatures higher than 30°C, indicating that conjugation occurs outside warm-blooded hosts. Using R27, the prototype of IncHI1 plasmids, we report that plasmid transfer efficiency in E. coli strongly depends on the physiological state of the donor cells. Conjugation frequency is high when cells are actively growing, dropping sharply when cells enter the stationary phase of growth...
October 21, 2016: Environmental Microbiology
Debarun Dutta, Ajay K Vijay, Naresh Kumar, Mark D P Willcox
Purpose: To determine the ability of antimicrobial peptide melimine-coated contact lenses to reduce the incidence of microbial keratitis (MK) in a rabbit model of contact lens wear. Methods: In vitro antimicrobial activity of melimine-coated contact lenses was determined against Pseudomonas aeruginosa by viable count and a radiolabeled assay. The amount of lipopolysaccharide (LPS) associated with bacteria bound to melimine-coated and control lenses was determined...
October 1, 2016: Investigative Ophthalmology & Visual Science
Elizabeth A Neuner, Andrea M Pallotta, Simon W Lam, David Stowe, Steven M Gordon, Gary W Procop, Sandra S Richter
OBJECTIVE To describe the impact of rapid diagnostic microarray technology and antimicrobial stewardship for patients with Gram-positive blood cultures. DESIGN Retrospective pre-intervention/post-intervention study. SETTING A 1,200-bed academic medical center. PATIENTS Inpatients with blood cultures positive for Staphylococcus aureus, Enterococcus faecalis, E. faecium, Streptococcus pneumoniae, S. pyogenes, S. agalactiae, S. anginosus, Streptococcus spp., and Listeria monocytogenes during the 6 months before and after implementation of Verigene Gram-positive blood culture microarray (BC-GP) with an antimicrobial stewardship intervention...
November 2016: Infection Control and Hospital Epidemiology
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"