keyword
MENU ▼
Read by QxMD icon Read
search

dynamical system

keyword
https://www.readbyqxmd.com/read/29145633/the-initiation-propagation-and-dynamics-of-crispr-spycas9-r-loop-complex
#1
Yan Zeng, Yang Cui, Yong Zhang, Yanruo Zhang, Meng Liang, Hui Chen, Jie Lan, Guangtao Song, Jizhong Lou
CRISPR-Cas9 system has been widely used for efficient genome editing. Although the structures of Cas9 protein in complex with single-guided RNA (sgRNA) and target DNA have been resolved, the molecular details about the formation of Cas9 endonuclease R-loop structure remain elusive. Here we examine the DNA cleavage activities of Streptococcus pyogenes Cas9 (SpyCas9) and its mutants using various target sequences and study the conformational dynamics of R-loop structure during target binding using single-molecule fluorescence energy transfer (smFRET) technique...
November 14, 2017: Nucleic Acids Research
https://www.readbyqxmd.com/read/29145469/development-of-visual-cortical-function-in-infant-macaques-a-bold-fmri-study
#2
Tom J Van Grootel, Alan Meeson, Matthias H J Munk, Zoe Kourtzi, J Anthony Movshon, Nikos K Logothetis, Lynne Kiorpes
Functional brain development is not well understood. In the visual system, neurophysiological studies in nonhuman primates show quite mature neuronal properties near birth although visual function is itself quite immature and continues to develop over many months or years after birth. Our goal was to assess the relative development of two main visual processing streams, dorsal and ventral, using BOLD fMRI in an attempt to understand the global mechanisms that support the maturation of visual behavior. Seven infant macaque monkeys (Macaca mulatta) were repeatedly scanned, while anesthetized, over an age range of 102 to 1431 days...
2017: PloS One
https://www.readbyqxmd.com/read/29145174/temperature-dependent-electron-paramagnetic-resonance-study-on-magnetoelectric-ycro3
#3
Ashish Kumar Mall, Ambesh Dixit, Ashish Garg, Rajeev Gupta
We report temperature dependent electron paramagnetic resonance (EPR) studies on polycrystalline YCrO3 samples at X-band (9.46 GHz) in the temperature range of 120 K-298 K. The EPR spectra exhibit a single broad line across the whole temperature range, attributed to Cr(3+) ions. The variation of EPR spectra parameters (line width, integrated intensity, and g-factor) as a function of temperature was analyzed to understand the nature of spin-dynamics in the paramagnetic region of YCrO3. A peak in the g-factor suggests the presence of a new phase within the paramagnetic state at an intermediate point of temperature T IP ~ 230 K, attributed to the onset of short range canted antiferromagnetic correlations in the material much above 140 K, Néel temperature (T N) of YCrO3...
November 16, 2017: Journal of Physics. Condensed Matter: An Institute of Physics Journal
https://www.readbyqxmd.com/read/29145141/characterizing-pollutant-emissions-from-mosquito-repellents-incenses-and-implications-in-risk-assessment-of-human-health
#4
Lina Wang, Xinran Zheng, Svetlana Stevanovic, Zhiyuan Xiang, Jing Liu, Huiwen Shi, Jing Liu, Mingzhou Yu, Chun Zhu
Mosquito-repellent incense is one of the most popular products used for dispelling mosquitos during summer in China. It releases large amounts of particulate and gaseous pollutants which constitute a potential hazard to human health. We conducted chamber experiment to characterize major pollutants from three types of mosquito-repellent incenses, further assessed the size-fractionated deposition in human respiratory system, and evaluated the indoor removing efficiency by fresh air. Results showed that the released pollutant concentrations were greater than permissible levels in regulations in GB3095-2012, as well as suggested by the World Health Organization (WHO)...
October 22, 2017: Chemosphere
https://www.readbyqxmd.com/read/29145066/relationship-between-follicular-dynamics-and-oocyte-maturation-during-in%C3%A2-vitro-culture-as-a-non-invasive-sign-of-caprine-oocyte-meiotic-competence
#5
J Cadenas, C Maside, A C A Ferreira, L A Vieira, J Leiva-Revilla, V M Paes, B G Alves, F Z Brandão, A P R Rodrigues, M B Wheeler, J R Figueiredo
The search for non-invasive signs of oocyte meiotic competence is very important for the development of in vitro follicle culture (IVFC) systems. The aims of the present study were: (1) to investigate the effect of in vitro maturation (IVM) of in vivo grown goat COCs, in group or individually, on oocyte chromatin configuration (Experiment 1), and (2) the influence of IVFC period (12 vs. 18 days) on the ability of the oocyte to resume meiosis immediately after IVFC (before in vitro maturation; IVM), or after IVM (Experiment 2)...
November 4, 2017: Theriogenology
https://www.readbyqxmd.com/read/29145021/production-of-chemicals-using-dynamic-control-of-metabolic-fluxes
#6
REVIEW
Peng Xu
Engineered microbial cell factories are constantly experiencing metabolic imbalance due to nutrients depletion, metabolites buildup, evolutionary pressure or genetic instability. It is important to equip the engineered cell factory with sensor-regulator system to enable cell adjust metabolism and respond to the changing environment. Dynamically allocating cellular resources and optimally controlling pathway expression have proved as promising strategies to manage the tradeoff between cell growth and product formation as well as improve the cost-competitiveness of industrial fermentation...
November 13, 2017: Current Opinion in Biotechnology
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#7
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29145005/assessment-of-long-term-spatio-temporal-radiofrequency-electromagnetic-field-exposure
#8
Sam Aerts, Joe Wiart, Luc Martens, Wout Joseph
As both the environment and telecommunications networks are inherently dynamic, our exposure to environmental radiofrequency (RF) electromagnetic fields (EMF) at an arbitrary location is not at all constant in time. In this study, more than a year's worth of measurement data collected in a fixed low-cost exposimeter network distributed over an urban environment was analysed and used to build, for the first time, a full spatio-temporal surrogate model of outdoor exposure to downlink Global System for Mobile Communications (GSM) and Universal Mobile Telecommunications System (UMTS) signals...
November 13, 2017: Environmental Research
https://www.readbyqxmd.com/read/29144977/birthplace-in-australia-processes-and-interactions-during-the-intrapartum-transfer-of-women-from-planned-homebirth-to-hospital
#9
Deborah Fox, Athena Sheehan, Caroline Homer
OBJECTIVE: the aim of the study was to explore the views and experiences of women, midwives and obstetricians on the intrapartum transfer of women from planned homebirth to hospital in Australia. DESIGN: a Constructivist Grounded Theory approach was taken, to conceptualise the social interactions and processes grounded in the data. SETTING: urban and regional areas in four states of south-eastern Australia. PARTICIPANTS: semi-structured qualitative interviews were conducted with 36 women, midwives and obstetricians who had experienced an intrapartum homebirth transfer within three years prior to the interview...
November 2, 2017: Midwifery
https://www.readbyqxmd.com/read/29144848/watching-the-evolution-of-the-american-family-amazon-s-transparent-ecological-systems-theory-and-the-changing-dynamics-of-public-opinion
#10
Amy B Becker, Maureen E Todd
Using Bronfenbrenner's (1979) ecological systems theory as an organizing framework, the research closely examines the text of the Amazon Studios hit show, Transparent, and by extension the evolution of public opinion towards transgender individuals. By examining the Pfefferman family in detail and their related microsystem and macrosystem, we are able to closely unpack the transition of Jeffrey Tambor's character from Mort to Maura and the show's connections with broader developments in the Los Angeles LGBT community and the Jewish diaspora in postwar and contemporary Los Angeles...
November 16, 2017: Journal of Homosexuality
https://www.readbyqxmd.com/read/29144732/ratiometric-detection-of-intracellular-lysine-and-ph-with-one-pot-synthesized-dual-emissive-carbon-dots
#11
Wei Song, Wenxiu Duan, Yinghua Liu, Zhongju Ye, Yonglei Chen, Hongli Chen, Shengda Qi, Jiang Wu, Dan Liu, Lehui Xiao, Cuiling Ren, Xingguo Chen
Recently, the development of new fluorescent probes for the ratiometric detection of target objects inside living cells has received great attention. Normally, the preparation, modification as well as conjugation procedures of these probes are complicated. On this basis, great efforts have been paid to establish convenient method for the preparation of dual emissive nanosensor. In this work, a functional dual emissive carbon dots (dCDs) was prepared by a one-pot hydrothermal carbonization method. The dCDs exhibits two distinctive fluorescence emission peaks at 440 and 624 nm with the excitation at 380 nm...
November 16, 2017: Analytical Chemistry
https://www.readbyqxmd.com/read/29144529/driving-dynamic-colloidal-assembly-using-eccentric-self-propelled-colloids
#12
Zhan Ma, Qun-Li Lei, Ran Ni
Designing protocols to dynamically direct the self-assembly of colloidal particles has become an important direction in soft matter physics because of promising applications in the fabrication of dynamic responsive functional materials. Here, using computer simulations, we found that in the mixture of passive colloids and eccentric self-propelled active particles, when the eccentricity and self-propulsion of active particles are high enough, the eccentric active particles can push passive colloids to form a large dense dynamic cluster, and the system undergoes a novel dynamic demixing transition...
November 16, 2017: Soft Matter
https://www.readbyqxmd.com/read/29144451/tidal-tomography-constrains-earth-s-deep-mantle-buoyancy
#13
Harriet C P Lau, Jerry X Mitrovica, James L Davis, Jeroen Tromp, Hsin-Ying Yang, David Al-Attar
Earth's body tide-also known as the solid Earth tide, the displacement of the solid Earth's surface caused by gravitational forces from the Moon and the Sun-is sensitive to the density of the two Large Low Shear Velocity Provinces (LLSVPs) beneath Africa and the Pacific. These massive regions extend approximately 1,000 kilometres upward from the base of the mantle and their buoyancy remains actively debated within the geophysical community. Here we use tidal tomography to constrain Earth's deep-mantle buoyancy derived from Global Positioning System (GPS)-based measurements of semi-diurnal body tide deformation...
November 15, 2017: Nature
https://www.readbyqxmd.com/read/29144436/an-in-silico-subject-variability-study-of-upper-airway-morphological-influence-on-the-airflow-regime-in-a-tracheobronchial-tree
#14
Yu Feng, Jianan Zhao, Xiaole Chen, Jiang Lin
Determining the impact of inter-subject variability on airflow pattern and nanoparticle deposition in the human respiratory system is necessary to generate population-representative models, useful for several biomedical engineering applications. Thus, the overall research objective is to quantitatively correlate geometric parameters and coupled transport characteristics of air, vapor, and nanoparticles. Focusing on identifying morphological parameters that significantly influence airflow field and nanoparticle transport, an experimentally validated computational fluid-particle dynamics (CFPD) model was employed to simulate airflow pattern in three human lung-airway configurations...
November 16, 2017: Bioengineering
https://www.readbyqxmd.com/read/29144409/how-well-can-we-extract-the-permanent-displacement-from-low-cost-mems-accelerometers
#15
Jyh Cherng Jan, Wei-An Chao, Yih-Min Wu, Chien-Chih Chen, Cheng-Horng Lin
Following the recent establishment of a high-density seismic network equipped with low-cost micro-electro-mechanical system (MEMS) P-wave-alert-device (P-Alert) by the earthquake early warning (EEW) research group at the National Taiwan University, a large quantity of strong-motion records from moderate-magnitude earthquakes (ML > 6) around Taiwan has been accumulated. Using a data preprocessing scheme to recover the dynamic average embedded within the P-Alert data, we adopted an automatic baseline correction approach for the P-Alert accelerograms to determine the coseismic deformation (Cd)...
November 16, 2017: Sensors
https://www.readbyqxmd.com/read/29144284/integrated-assessment-and-scenarios-simulation-of-urban-water-security-system-in-the-southwest-of-china-with-system-dynamics-analysis
#16
Su Yin, Guan Dongjie, Su Weici, Gao Weijun
The demand for global freshwater is growing, while global freshwater available for human use is limited within a certain time and space. Its security has significant impacts on both the socio-economic system and ecological system. Recently, studies have focused on the urban water security system (UWSS) in terms of either water quantity or water quality. In this study, water resources, water environment, and water disaster issues in the UWSS were combined to establish an evaluation index system with system dynamics (SD) and geographic information systems (GIS)...
November 2017: Water Science and Technology: a Journal of the International Association on Water Pollution Research
https://www.readbyqxmd.com/read/29144205/lessons-in-effector-and-nlr-biology-of-plant-microbe-systems
#17
Aleksandra Białas, Erin K Zess, Juan Carlos De la Concepcion, Marina Franceschetti, Helen G Pennington, Kentaro Yoshida, Jessica L Upson, Emilie Chanclud, Chih-Hang Wu, Thorsten Langner, Abbas Maqbool, Freya A Varden, Lida Derevnina, Khaoula Belhaj, Koki Fujisaki, Hiromasa Saitoh, Ryohei Terauchi, Mark J Banfield, Sophien Kamoun
A diversity of plant-associated organisms secrete effectors-proteins and metabolites that modulate plant physiology to favor host infection and colonization. However, effectors can also activate plant immune receptors, notably nucleotide-binding domain and leucine-rich repeat region (NLR)-containing proteins, enabling plants to fight off invading organisms. This interplay between effectors, their host targets, and the matching immune receptors is shaped by intricate molecular mechanisms and exceptionally dynamic coevolution...
November 16, 2017: Molecular Plant-microbe Interactions: MPMI
https://www.readbyqxmd.com/read/29144139/a-multiscale-simulation-platform-linking-lithium-ion-battery-electrode-fabrication-process-with-performance-at-the-cell-level
#18
Alain Ngandjong, Alexis Rucci, Mariem Maiza, Garima Shukla, Jorge Gabriel Vazquez-Arenas, Alejandro A Franco
A novel multiscale modeling platform is proposed to demonstrate the importance of particle assembly during battery electrode fabrication by showing its effect on battery performance. For the first time, a discretized 3D electrode resulting from the simulation of its fabrication, has been incorporated within a 3D continuum performance model. The study used LiNiMnCoO2 as active material where effect of change of electrode formulation is explored for three cases, namely 85:15, 90:10, and 95:5, as ratios between active material and carbon-binder domains...
November 16, 2017: Journal of Physical Chemistry Letters
https://www.readbyqxmd.com/read/29143909/design-of-an-optimum-poincar%C3%A3-plane-for-extracting-meaningful-samples-from-eeg-signals
#19
Babak Sharif, Amir Homayoun Jafari
Biosignals are considered as important sources of data for diagnosing and detecting abnormalities, and modeling dynamics in the body. These signals are usually analyzed using features taken from time and frequency domain. In theory' these dynamics can also be analyzed utilizing Poincaré plane that intersects system's trajectory. However' selecting an appropriate Poincaré plane is a crucial part of extracting best Poincaré samples. There is no unique way to choose a Poincaré plane' because it is highly dependent to the system dynamics...
November 16, 2017: Australasian Physical & Engineering Sciences in Medicine
https://www.readbyqxmd.com/read/29143883/rooting-depth-varies-differentially-in-trees-and-grasses-as-a-function-of-mean-annual-rainfall-in-an-african-savanna
#20
Ricardo M Holdo, Jesse B Nippert, Michelle C Mack
A significant fraction of the terrestrial biosphere comprises biomes containing tree-grass mixtures. Forecasting vegetation dynamics in these environments requires a thorough understanding of how trees and grasses use and compete for key belowground resources. There is disagreement about the extent to which tree-grass vertical root separation occurs in these ecosystems, how this overlap varies across large-scale environmental gradients, and what these rooting differences imply for water resource availability and tree-grass competition and coexistence...
November 16, 2017: Oecologia
keyword
keyword
89511
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"