keyword
MENU ▼
Read by QxMD icon Read
search

pseudomonas infection

keyword
https://www.readbyqxmd.com/read/29150962/genotype-and-diet-affect-resistance-survival-and-fecundity-but-not-fecundity-tolerance
#1
Megan A M Kutzer, Joachim Kurtz, Sophie A O Armitage
Insects are exposed to a variety of potential pathogens in their environment, many of which can severely impact fitness and health. Consequently, hosts have evolved resistance and tolerance strategies to suppress or cope with infections. Hosts utilising resistance improve fitness by clearing or reducing pathogen loads and hosts utilising tolerance reduce harmful fitness effects per pathogen load. To understand variation in, and selective pressures on resistance and tolerance we asked to what degree they are shaped by host genetic background, whether plasticity in these responses depends upon dietary environment, and whether there are interactions between these two factors...
November 18, 2017: Journal of Evolutionary Biology
https://www.readbyqxmd.com/read/29150546/differential-regulation-of-two-tiered-plant-immunity-and-sexual-reproduction-by-anxur-receptor-like-kinases
#2
Hyunggon Mang, Baomin Feng, Zhangjian Hu, Aurelien Boisson-Dernier, Christina Franck, Xiangzong Meng, Yanyan Huang, Jinggeng Zhou, Guangyuan Xu, Taotao Wang, Libo Shan, Ping He
Plants have evolved two tiers of immune receptors to detect infections: cell surface-resident pattern recognition receptors (PRRs) that sense microbial signatures and intracellular nucleotide-binding domain leucine-rich repeat (NLR) proteins that recognize pathogen effectors. How PRRs and NLRs interconnect and activate the specific and overlapping plant immune responses remains elusive. A genetic screen for components controlling plant immunity identified ANXUR1 (ANX1), a malectin-like domain-containing receptor-like kinase, together with its homolog ANX2, as important negative regulators of both PRR- and NLR-mediated immunity in Arabidopsis thaliana...
November 17, 2017: Plant Cell
https://www.readbyqxmd.com/read/29150357/caregiver-burden-of-parents-of-young-children-with-cystic-fibrosis
#3
C Fitzgerald, S George, R Somerville, B Linnane, P Fitzpatrick
BACKGROUND: There is a paucity of research examining the impact of informal caregiving on parents of young children with cystic fibrosis (CF). The aim of this study was to examine caregiver burden and identify risk factors associated with high caregiver burden in mothers and fathers of young children with CF. METHODS: This was a cross-sectional study of parents of young children with CF. A total of 213 families were invited to complete the CarerQoL questionnaire, a validated tool composed of two parts: (i) the CarerQol-7D which describes the care situation in terms of the negative and positive effects of caregiving and (ii) the visual analogue scale (VAS) which measures happiness on a scale from 0 to 10 (0=completely unhappy and 10=completely happy)...
November 14, 2017: Journal of Cystic Fibrosis: Official Journal of the European Cystic Fibrosis Society
https://www.readbyqxmd.com/read/29149978/perioperative-prophylaxis-for-total-artificial-heart-transplantation
#4
H E Chambers, P Pelish, F Qiu, D F Florescu
BACKGROUND: Practice variation regarding perioperative antimicrobial prophylaxis in total artificial heart transplantations (TAH-t) across institutions is unknown. The aim of our survey was to assess the current practices for prevention of infection in TAH-t recipients among different programs. METHODS: An electronic survey was sent to programs that implant Syncardia TAH (Syncardia Systems, Tuscon, Ariz, USA). Proportions were analyzed for categorical variables; means and SDs were analyzed for continuous variables...
November 2017: Transplantation Proceedings
https://www.readbyqxmd.com/read/29149337/mechanisms-leading-to-in-vivo-ceftolozane-tazobactam-resistance-development-during-the-treatment-of-infections-caused-by-mdr-pseudomonas-aeruginosa
#5
Pablo A Fraile-Ribot, Gabriel Cabot, Xavier Mulet, Leonor Periañez, M Luisa Martín-Pena, Carlos Juan, José L Pérez, Antonio Oliver
Objectives: Characterization of the mechanisms driving ceftolozane/tazobactam resistance development in 5 of 47 (10.6%) patients treated for MDR Pseudomonas aeruginosa infections in a Spanish hospital. Methods: Five pairs of ceftolozane/tazobactam-susceptible/resistant P. aeruginosa isolates were studied. MICs were determined by broth microdilution, clonal relatedness was assessed by MLST and resistance mechanisms were investigated by phenotypic and genotypic methods, including WGS...
November 14, 2017: Journal of Antimicrobial Chemotherapy
https://www.readbyqxmd.com/read/29149302/activity-of-colistin-alone-or-in-combination-with-rifampicin-or-meropenem-in-a-carbapenem-resistant-bioluminescent-pseudomonas-aeruginosa-intraperitoneal-murine-infection-model
#6
Yun Cai, Deqing Yang, Jin Wang, Rui Wang
Background: Carbapenem-resistant Pseudomonas aeruginosa (CRPA) infections represent a major therapeutic problem and combination therapy may be the chemotherapeutic option. Methods: Bioluminescent CRPA was developed through sequential subcultures in subinhibitory concentrations of meropenem from an engineered strain of bioluminescent PA Xen5. Then CRPA was injected intraperitoneally to establish an intraperitoneal murine infection model. Treatments of colistin alone or combined with rifampicin or meropenem were started 1 h after infection...
November 14, 2017: Journal of Antimicrobial Chemotherapy
https://www.readbyqxmd.com/read/29146575/lumacaftor-vx-809-restores-the-ability-of-cf-macrophages-to-phagocytose-and-kill-pseudomonas-aeruginosa
#7
Roxanna Barnaby, Katja Koeppen, Amanda Nymon, Thomas H Hampton, Brent Berwin, Alix Ashare, Bruce Stanton
Cystic Fibrosis (CF), the most common lethal genetic disease in Caucasians, is characterized by chronic bacterial lung infection and excessive inflammation, which leads to progressive loss of lung function, and premature death. Although ivacaftor (VX-770) and the combination of ivacaftor and lumacaftor (VX-809) improve lung function in CF patients with the Gly551Asp and del508Phe mutation, respectively, the effects of these drugs on the function of human CF macrophages are unknown. Thus, studies were conducted to examine the effects of lumacaftor alone and in combination with ivacaftor (i...
November 16, 2017: American Journal of Physiology. Lung Cellular and Molecular Physiology
https://www.readbyqxmd.com/read/29146549/risk-assessment-of-infected-children-with-pseudomonas-aeruginosa-pneumonia-by-combining-host-and-pathogen-predictors
#8
Jiayi Chen, Yuhang Chen, Pengwei Hu, Tao Zhou, Xin Xu, Xiaofang Pei
The current criteria of pneumonia severity, which mainly depend on clinical manifestations and laboratory findings from blood routine tests and X-ray examination, are still of great significance in preliminary diagnosis. However, the utility of traditional severe pneumonia indexes (SPI) without considering high virulence and multidrug resistance of Pseudomonas aeruginosa has limitations. Thus, it is of great value to make a risk assessment, which can serve as a complementary option for incomplete clinical diagnosis...
November 13, 2017: Infection, Genetics and Evolution
https://www.readbyqxmd.com/read/29146531/specific-oxygenation-of-plasma-membrane-phospholipids-by-pseudomonas-aeruginosa-lipoxygenase-induces-structural-and-functional-alterations-in-mammalian-cells
#9
Maceler Aldrovandi, Swathi Banthiya, Sven Meckelmann, You Zhou, Dagmar Heydeck, Valerie B O'Donnell, Hartmut Kuhn
Pseudomonas aeruginosa is a gram-negative pathogen, which causes life-threatening infections in immunocompromized patients. These bacteria express a secreted lipoxygenase (PA-LOX), which oxygenates free arachidonic acid to 15S-hydro(pero)xyeicosatetraenoic acid. It binds phospholipids at its active site and physically interacts with lipid vesicles. When incubated with red blood cells membrane lipids are oxidized and hemolysis is induced but the structures of the oxygenated membrane lipids have not been determined...
November 13, 2017: Biochimica et Biophysica Acta
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#10
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29144965/role-of-serum-1-3%C3%AE-d-glucan-assay-in-early-diagnosis-of-invasive-fungal-infections-in-a-neonatal-intensive-care-unit
#11
Abd Elazeez Shabaan, Lobna Mahmoud Elbaz, Wafaa M El-Emshaty, Basma Shouman
OBJECTIVES: To study the microbiological pattern of late onset neonatal sepsis cultures and to assess the diagnostic performance of serum (1,3)-β-d-glucan level for early diagnosis of invasive fungemia in high-risk infants admitted to a neonatal intensive care unit. METHODS: A prospective multicenter clinical trial conducted on infants at high risk for invasive fungal infections, with suspected late onset sepsis, admitted to a neonatal intensive care unit at Mansoura University Children's Hospital and Mansoura General Hospital between March 2014 and February 2016...
November 13, 2017: Jornal de Pediatria
https://www.readbyqxmd.com/read/29143505/-inhaled-antibiotics-for-the-management-of-non-cystic-fibrosis-bronchiectasis
#12
Gregory Berra, Émilie Chappuis-Gisin, Paola M Soccal, Jérôme Plojoux
Bronchiectasis is irreversible bronchial dilatation associated with chronic respiratory symptoms. Management is aimed at reducing symptoms and slowing the progression of the disease by interrupting the vicious circle: bronchial infection, inflammation, altered mucociliary clearance, lung destruction. Unlike the literature on inhaled antibiotics in cystic fibrosis, literature data are limited and of low quality for bronchiectasis of other causes. However, new recommendations from the European Respiratory Society propose the conditional use of inhaled antibiotics to prevent repeated infectious exacerbations and to eradicate Pseudomonas aeruginosa colonization...
November 15, 2017: Revue Médicale Suisse
https://www.readbyqxmd.com/read/29142383/assessment-of-doripenem-meropenem-and-imipenem-against-respiratory-isolates-of-pseudomonas-aeroginosa-in-a-tertiary-care-hospital-of-north-india
#13
Arti Negi, Mridu Anand, Avinash Singh, Awadhesh Kumar, Chinmoy Sahu, Kashi Nath Prasad
Objective: Pseudomonas aeruginosa is one of the leading pathogen causing healthcare-associated infections, particularly in immunocompromised and critically ill patients. The development of carbapenem resistance in P. aeruginosa infections is worrisome. Data specifically comparing the susceptibility of the three available carbapenems are lacking in the Indian subcontinent. Materials and Methods: We evaluated the minimum inhibitory concentrations (MICs) of the three commonly used carbapenems- imipenem, meropenem, and doripenem against, 435 P...
October 2017: Indian Journal of Critical Care Medicine
https://www.readbyqxmd.com/read/29142299/the-immunomodulatory-drug-glatiramer-acetate-is-also-an-effective-antimicrobial-agent-that-kills-gram-negative-bacteria
#14
Stig Hill Christiansen, Ronan A Murphy, Kristian Juul-Madsen, Marlene Fredborg, Michael Lykke Hvam, Esben Axelgaard, Sandra M Skovdal, Rikke Louise Meyer, Uffe B Skov Sørensen, Arne Möller, Jens Randel Nyengaard, Niels Nørskov-Lauritsen, Mikala Wang, Mihaela Gadjeva, Kenneth A Howard, Jane C Davies, Eskild Petersen, Thomas Vorup-Jensen
Classic drug development strategies have failed to meet the urgent clinical needs in treating infections with Gram-negative bacteria. Repurposing drugs can lead to timely availability of new antibiotics, accelerated by existing safety profiles. Glatiramer acetate (GA) is a widely used and safe formulation for treatment of multiple sclerosis. It contains a large diversity of essentially isomeric polypeptides with the cationic and amphiphilic character of many antimicrobial peptides (AMP). Here, we report that GA is antibacterial, targeting Gram-negative organisms with higher activity towards Pseudomonas aeruginosa than the naturally-occurring AMP LL-37 in human plasma...
November 15, 2017: Scientific Reports
https://www.readbyqxmd.com/read/29140982/development-standardization-and-testing-of-a-bacterial-wound-infection-model-based-on-ex-vivo-human-skin
#15
Christoph Schaudinn, Christin Dittmann, Jana Jurisch, Michael Laue, Nazende Günday-Türeli, Ulrike Blume-Peytavi, Annika Vogt, Fiorenza Rancan
Current research on wound infections is primarily conducted on animal models, which limits direct transferability of these studies to humans. Some of these limitations can be overcome by using-otherwise discarded-skin from cosmetic surgeries. Superficial wounds are induced in fresh ex vivo skin, followed by intradermal injection of Pseudomonas aeruginosa under the wound. Subsequently, the infected skin is incubated for 20 hours at 37°C and the CFU/wound are determined. Within 20 hours, the bacteria count increased from 107 to 109 bacteria per wound, while microscopy revealed a dense bacterial community in the collagen network of the upper wound layers as well as numerous bacteria scattered in the dermis...
2017: PloS One
https://www.readbyqxmd.com/read/29138047/antibacterial-effect-and-dna-delivery-using-a-combination-of-an-arsonium-containing-lipophosphoramide-with-an-n-heterocyclic-carbene-silver-complex-potential-benefits-for-cystic-fibrosis-lung-gene-therapy
#16
Angélique Mottais, Mathieu Berchel, Yann Sibiril, Véronique Laurent, Deborah Gill, Stephen Hyde, Paul-Alain Jaffrès, Tristan Montier, Tony Le Gall
Cystic Fibrosis (CF), the most common chronic genetic disorder among the Caucasian population, is a life-threatening disease mainly due to respiratory failures resulting from chronic infections and inflammation. Although research in the pharmacological field has recently made significant progress, gene therapy still remains a promising strategy to cure CF, especially because it should be applicable to any patient whatever the mutation profile. Until now, little attention has been paid to bacterial lung infections with regard to gene delivery to the airways; yet, this could greatly impact on the success of gene therapy...
November 11, 2017: International Journal of Pharmaceutics
https://www.readbyqxmd.com/read/29136469/novel-linear-lipopeptide-paenipeptins-with-potential-for-eradicating-biofilms-and-sensitizing-gram-negative-bacteria-to-rifampicin-and-clarithromycin
#17
Sun Hee Moon, Xuan Zhang, Guangrong Zheng, Daniel G Meeker, Mark S Smeltzer, En Huang
We report the structure-activity relationship (SAR) analyses of 17 linear lipopeptide paenipeptin analogues. Analogues 7, 12 and 17 were more potent than the lead compound. Analogue 17 was active against carbapenem-resistant and polymyxin-resistant pathogens. This compound at 40 μg/mL resulted in 3 log and 2.6 log reductions of methicillin-resistant Staphylococcus aureus and Pseudomonas aeruginosa, respectively, in catheter-associated biofilms in vitro. Analogue 17 showed little hemolysis at 32 µg/ml and lysed 11% of red blood cells at 64 µg/ml...
November 14, 2017: Journal of Medicinal Chemistry
https://www.readbyqxmd.com/read/29135250/structure-activity-relationships-of-6-and-8-gingerol-analogs-as-anti-biofilm-agents
#18
Hyunsuk Choi, So-Young Ham, Eunji Cha, Yujin Shin, Han-Shin Kim, Jeong Kyu Bang, Sang-Hyun Son, Hee-Deung Park, Youngjoo Byun
Pseudomonas aeruginosa is a causative agent of chronic infections in immunocompromised patients. Disruption of quorum sensing circuits is an attractive strategy for treating diseases associated with P. aeruginosa infection. In this study, we designed and synthesized a series of gingerol analogs targeting LasR, a master regulator of quorum sensing networks in P. aeruginosa. Structure-activity relationship studies showed that a hydrogen-bonding interaction in the head section, stereochemistry and rotational rigidity in the middle section, and optimal alkyl chain length in the tail section are important factors for the enhancement of LasR-binding affinity and for the inhibition of biofilm formation...
November 14, 2017: Journal of Medicinal Chemistry
https://www.readbyqxmd.com/read/29133883/pseudomonas-aeruginosa-defends-against-phages-through-type-iv-pilus-glycosylation
#19
Hanjeong Harvey, Joseph Bondy-Denomy, Hélène Marquis, Kristina M Sztanko, Alan R Davidson, Lori L Burrows
Since phages present a major challenge to survival in most environments, bacteria express a battery of anti-phage defences including CRISPR-Cas, restriction-modification and abortive infection systems (1-4) . Such strategies are effective, but the phage genome-which encodes potentially inhibitory gene products-is still allowed to enter the cell. The safest way to preclude phage infection is to block initial phage adsorption to the cell. Here, we describe a cell-surface modification that blocks infection by certain phages...
November 13, 2017: Nature Microbiology
https://www.readbyqxmd.com/read/29133568/activity-of-ceftolozane-tazobactam-against-carbapenem-resistant-carbapenemase-non-producing-pseudomonas-aeruginosa-and-associated-resistance-mechanisms
#20
Yu Mi Wi, Kerryl E Greenwood-Quaintance, Audrey N Schuetz, Kwan Soo Ko, Kyong Ran Peck, Jae-Hoon Song, Robin Patel
Although carbapenems are effective for treating serious multidrug-resistant Pseudomonas aeruginosa infections, carbapenem-resistant P. aeruginosa (CRPA) is now being reported worldwide. Ceftolozane/tazobactam (C/T) demonstrates activity against many multidrug-resistant isolates. We evaluated the activity of C/T and compared its activity to that of ceftazidime/avibactam (C/A) using a well-characterized collection of carbapenemase non-producing CRPA isolates. Forty-two carbapenemase non-producing CRPA isolates from a previous study (Int J Antimicrob Agents 2012;40:168-72) were included...
November 13, 2017: Antimicrobial Agents and Chemotherapy
keyword
keyword
80860
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"