keyword
MENU ▼
Read by QxMD icon Read
search

LC-MS/MS

keyword
https://www.readbyqxmd.com/read/28092855/lc-ms-ms-determination-of-d-mannose-in-human-serum-as-a-potential-cancer-biomarker
#1
Lyndsey White, Jing Ma, Su Liang, Beatriz Sanchez-Espiridion, Dong Liang
Several metabolites in human serum have been identified as potential cancer biomarkers for early detection. This study focuses on the LC-MS/MS method development and validation of d-mannose in human serum. Surrogate blank serum, coupled with stable isotope d-mannose-(13)C6, as internal standard, was used for generating standard curves ranging from 1 to 50μg/mL. Separation was achieved by an Agilent 1200 series HPLC equipped with a SUPELCOGELTM Pb, 6% Crosslinked column with HPLC water as a mobile phase at flow rate of 0...
December 28, 2016: Journal of Pharmaceutical and Biomedical Analysis
https://www.readbyqxmd.com/read/28092216/metabolism-of-metofluthrin-in-rats-i-identification-of-metabolites
#2
Jun Abe, Hirohisa Nagahori, Hirokazu Tarui, Yoshitaka Tomigahara, Naohiko Isobe
Metofluthrin (2,3,5,6-tetrafluoro-4-(methoxymethyl)benzyl (Z/E)-(1R)-trans-2,2-dimethyl-3-(1-propenyl)-cyclopropanecarboxylate) is a novel pyrethroid insecticide, which has E/Z isomers at prop-1-enyl group. Rats were orally dosed with each [(14)C]-labeled E/Z isomer, and the excreta were collected for isolation and identification of metabolites. Analysis of the excreta by LC/MS and NMR revealed formation of 33 and 23 (total 42) metabolites from rats dosed with Z-isomer and E-isomer, respectively. Major metabolic reactions were cleavage of ester linkage, O-demethylation, hydroxylation, epoxidation or reduction of double bond, glutathione conjugation and its further metabolism, hydroxylation of epoxide, and formation of lactone ring...
January 16, 2017: Xenobiotica; the Fate of Foreign Compounds in Biological Systems
https://www.readbyqxmd.com/read/28092108/pharmacokinetics-and-pharmacodynamics-of-the-injectable-formulation-of-methadone-hydrochloride-and-methadone-in-lipid-nanocarriers-administered-orally-to-horses
#3
N Crosignani, S P Luna, T Dalla Costa, E L Pimenta, C B Detoni, S S Guterres, J N Puoli Filho, J C Pantoja, M C Pigatto
We investigated the thermal, electrical and mechanical antinociceptive and physiological effects (heart rate, respiratory rate, arterial blood pressure, head height and abdominal auscultation score), and pharmacokinetics, of 0.5 mg/kg of the injectable formulation (ORAL) or nanoparticulated methadone (NANO) given orally, in six adult mares, using a crossover, blind and prospective design. Repeated-measure models were used to compare parametric data between and within treatments, followed by Tukey's test. Nonparametric data were analysed with Wilcoxon signed-rank, adjusted by Bonferroni tests...
January 16, 2017: Journal of Veterinary Pharmacology and Therapeutics
https://www.readbyqxmd.com/read/28091940/purification-and-sequence-characterization-of-chondroitin-sulfate-and-dermatan-sulfate-from-fishes
#4
Na Lin, Xiaoli Mo, Yang Yang, Hong Zhang
Chondroitin sulfate (CS) and dermatan sulfate (DS) were extracted and purified from skins or bones of salmon (Salmo salar), snakehead (Channa argus), monkfish (Lophius litulon) and skipjack tuna (Katsuwonus pelamis). Size, structural sequences and sulfate groups of oligosaccharides in the purified CS and DS could be characterized and identified using high performance liquid chromatography (HPLC) combined with Orbitrap mass spectrometry. CS and DS chain structure varies depending on origin, but motif structure appears consistent...
January 14, 2017: Glycoconjugate Journal
https://www.readbyqxmd.com/read/28091797/mass-spectrometric-identification-of-phenol-soluble-modulins-in-the-atcc%C3%A2-43300-standard-strain-of-methicillin-resistant-staphylococcus-aureus-harboring-two-distinct-phenotypes
#5
K S Jang, M Park, J Y Lee, J S Kim
Staphylococcus aureus subsp. aureus Rosenbach (ATCC® 43300™) is a representative methicillin-resistant S. aureus (MRSA) strain that is used as a quality control strain for testing the methicillin susceptibility of clinical isolates. It has been consistently observed that colonies with two different colors (golden yellow and white) grow from the ATCC stock on blood agar plates. In this study, staphylococcal peptide and protein profiling was performed using matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry...
January 14, 2017: European Journal of Clinical Microbiology & Infectious Diseases
https://www.readbyqxmd.com/read/28091618/chemical-isotope-labeling-lc-ms-for-monitoring-disease-progression-and-treatment-in-animal-models-plasma-metabolomics-study-of-osteoarthritis-rat-model
#6
Deying Chen, Xiaoling Su, Nan Wang, Yunong Li, Hua Yin, Liang Li, Lanjuan Li
We report a chemical isotope labeling (CIL) liquid chromatography mass spectrometry (LC-MS) method generally applicable for tracking metabolomic changes from samples collected in an animal model for studying disease development and treatment. A rat model of surgically induced osteoarthritis (OA) was used as an example to illustrate the workflow and technical performance. Experimental duplicate analyses of 234 plasma samples were carried out using dansylation labeling LC-MS targeting the amine/phenol submetabolome...
January 16, 2017: Scientific Reports
https://www.readbyqxmd.com/read/28090779/preparation-and-in-vitro-in-vivo-evaluation-of-metformin-hydrochloride-rectal-dosage-forms-for-treatment-of-patients-with-type-ii-diabetes
#7
Abdel-Azim Zaghloul, Ahmad Lila, Fathy Abd-Allah, Aly Nada
BACKGROUND: Metformin hydrochloride (MtHCL) is an oral antidiabetic drug and has many other therapeutic benefits. It has poor bioavailability, narrow absorption window and extensive liver metabolism. Moreover, children and elders face difficulty to swallow the commercial oral tablets. OBJECTIVES: Preparation, in vitro/in vivo evaluation of MtHCL suppositories for rectal administration to solve some of these problems. METHODS: Suppository fatty bases (Witepsol®, Suppocire® and Massa®; different grades) and PEG bases 1000, 4000 and 6000 (different ratios), were used to prepare rectal suppository formulations each containing 500 mg drug...
January 16, 2017: Journal of Drug Targeting
https://www.readbyqxmd.com/read/28090677/elucidation-of-stress-induced-degradation-products-of-mangiferin-method-development-and-validation
#8
Rajneet Kaur Khurana, Satvinder Kaur, Jasleen Kaur, Bhupinder Singh
The degradation behavior of Mangiferin, under different ICH Q1A(R2) recommended stress conditions was studied using an isocratic elution with mobile phase (pH 2.4), composed of acetonitrile and 1% orthophosphoric acid (12:88 v/v) at a flow rate of 1.0 mL/min, with λmax 262 nm. It was suitably adapted for LC-MS studies by replacing with 1% acetic acid (ACN:1%acetic acid; 18:82) and pH was adjusted to 3.0. Extensive degradation was found to occur during alkaline medium stress studies at 2.31 min at λmax of 235 nm...
January 15, 2017: Biomedical Chromatography: BMC
https://www.readbyqxmd.com/read/28089894/determining-the-cleavage-site-for-the-mature-antimicrobial-peptide-of-nile-tilapia-%C3%AE-defensin-using-2d-electrophoresis-western-blot-and-mass-spectrometry-analysis
#9
Chin-I Chang, Li-Hao Chen, Yeh-Fang Hu, Chia-Che Wu, Jyh-Ming Tsai
Several proteomic techniques were used to determine the cleavage site of the mature antimicrobial peptide of Nile tilapia β-defensin. The computer-predicted Nile tilapia β-defensin ((25)ASFPWSCLSLSGVCRKVCLPTELFFGPLGCGKGSLCCVSHFL(66)) composed of 42 amino acids was chemically synthesized and prepared to produce an antibody for Western blotting. Total proteins from the skin of the Nile tilapia were separated on two-dimensional electrophoresis, and the spot of Nile tilapia β-defensin was recognized using Western blot analysis...
January 9, 2017: Fish & Shellfish Immunology
https://www.readbyqxmd.com/read/28089716/a-characterization-of-the-antimalarial-activity-of-the-bark-of-cylicodiscus-gabunensis-harms
#10
Omar Aldulaimi, Fidelia I Uche, Hamza Hameed, Haddijatou Mbye, Imran Ullah, Falko Drijfhout, Timothy D W Claridge, Paul Horrocks, Wen-Wu Li
ETHNOPHARMACOLOGICAL RELEVANCE AND AIM: A decoction of the bark of Cylicodiscus gabunensis Harms is used as a traditional medicine in the treatment of malaria in Nigeria. This study aims to validate the antimalarial potency of this decoction in vitro against Plasmodium falciparum and define potential bioactive constituents within the C. gabunensis bark. MATERIALS AND METHODS: A bioassay-guided separation and fractionation protocol was applied to C. gabunensis extracts, exploiting the use of a Malaria Sybr Green I Fluorescence assay method to monitor antiproliferative effects on parasites as well as define 50% inhibition concentrations...
January 9, 2017: Journal of Ethnopharmacology
https://www.readbyqxmd.com/read/28089346/detection-of-unusual-very-long-chain-fatty-acid-and-ether-lipid-derivatives-in-the-fibroblasts-and-plasma-of-patients-with-peroxisomal-diseases-using-liquid-chromatography-mass-spectrometry
#11
Shigeo Takashima, Kayoko Toyoshi, Takahiro Itoh, Naomi Kajiwara, Ayako Honda, Akiko Ohba, Shoko Takemoto, Satoshi Yoshida, Nobuyuki Shimozawa
Metabolic changes occur in patients with peroxisomal diseases owing to impairments in the genes involved in peroxisome function. For diagnostic purposes, saturated very-long-chain fatty acids (VLCFAs) such as C24:0 and C26:0, phytanic acid, pristanic acid, and plasmalogens are often measured as metabolic hallmarks. As the direct pathology of peroxisomal disease is yet to be fully elucidated, we sought to explore the fatty acid species that accumulate in patients with peroxisomal diseases. We developed a method for detecting a range of fatty acids implicated in peroxisomal diseases such as Zellweger syndrome (ZS) and X-linked adrenoleukodystrophy (X-ALD)...
January 7, 2017: Molecular Genetics and Metabolism
https://www.readbyqxmd.com/read/28088695/deep-metabolome-annotation-in-natural-products-research-towards-a-virtuous-cycle-in-metabolite-identification
#12
REVIEW
Pierre-Marie Allard, Grégory Genta-Jouve, Jean-Luc Wolfender
Natural products (NPs) research is changing and rapidly adopting cutting-edge tools, which radically transform the way to characterize extracts and small molecules. With the innovations in metabolomics, early integration of deep metabolome annotation information allows to efficiently guide the isolation of valuable NPs only and, in parallel, to generate massive metadata sets for the study of given extracts under various perspectives. This is the case for chemotaxonomy studies where common biosynthetic traits among species can be evidenced, but also for drug discovery purpose where such traits, in combination with bioactivity studies on extracts, may evidence bioactive molecules even before their isolation...
January 12, 2017: Current Opinion in Chemical Biology
https://www.readbyqxmd.com/read/28088372/nanoformulation-of-dual-bexarotene-tailed-phospholipid-conjugate-with-high-drug-loading
#13
Ruiyu He, Yawei Du, Longbing Ling, Muhammad Ismail, Yongpeng Hou, Chen Yao, Xinsong Li
Bexarotene (Bex), a synthetic retinoid X receptor-selective activator, has been proved to be an efficacious chemotherapeutic agent. But, its clinical application is limited due to the poor solubility. In this report, dual bexarotene-tailed phospholipid (DBTP) conjugate based nanovesicles were prepared in order to develop new nanoformulation. DBTP conjugate was first synthesized by conjugating two Bex molecules with glycerophosphorylcholine (GPC) through facial esterification. The amphiphilic DBTP nanovesicles were prepared without any additive by reverse-phase evaporation method...
January 11, 2017: European Journal of Pharmaceutical Sciences
https://www.readbyqxmd.com/read/28088103/chemically-enzymatic-synthesis-of-photosensitive-dna
#14
Kinga Westphal, Magdalena Zdrowowicz, Agnieszka Zylicz-Stachula, Janusz Rak
The sensitizing propensity of radio-/photosensitizing nucleoside depends on DNA sequence surrounding a sensitizer. Therefore, in order to compare sensitizers with regard to their ability to induce a DNA damage one has to study the sequence dependence of damage yield. However, chemical synthesis of oligonucleotides labeled with sensitizing nucleosides is hindered due to the fact that a limited number of such nucleoside phosphoramidites are accessible. Here, we report on a chemically-enzymatic method, employing a DNA polymerase and ligase, that enables a modified nucleoside, in the form of its 5'-triphosphate, to be incorporated into DNA fragment in a pre-determined site...
January 5, 2017: Journal of Photochemistry and Photobiology. B, Biology
https://www.readbyqxmd.com/read/28088044/dried-haematic-microsamples-and-lc-ms-ms-for-the-analysis-of-natural-and-synthetic-cannabinoids
#15
Michele Protti, James Rudge, Angelo Eliseo Sberna, Gilberto Gerra, Laura Mercolini
Synthetic cannabinoids are new psychoactive substances (NPS) with similar effects when compared to natural ones found in Cannabis derivatives. They have rapidly integrated into the illicit market, often sold as alternatives under international control. The need to identify and quantify an unprecedented and growing number of new compounds represents a unique challenge for toxicological, forensic and anti-doping analysis. Dried blood spots have been used within the bioanalytical framework in place of plasma or serum, in order to reduce invasiveness, lower sample size, simplify handling, storage and shipping of samples and to facilitate home-based and on-field applications...
December 30, 2016: Journal of Chromatography. B, Analytical Technologies in the Biomedical and Life Sciences
https://www.readbyqxmd.com/read/28088042/strategies-for-metabolite-profiling-based-on-liquid-chromatography
#16
REVIEW
Javier Saurina, Sonia Sentellas
This paper aims at covering the principal strategies based on liquid chromatography (LC) for metabolite profiling in the field of drug discovery and development. The identification of metabolites generated in the organism is an important task during the early stages of preclinical research to define the most proper strategy for optimizing, adjusting metabolic clearance and minimizing bioactivation. An early assessment of the metabolite profile may be critical since metabolites can contribute to pharmacological and/or toxicological effects...
January 9, 2017: Journal of Chromatography. B, Analytical Technologies in the Biomedical and Life Sciences
https://www.readbyqxmd.com/read/28087970/liquid-chromatography-mass-spectrometry-high-resolution-for-the-determination-of-baclofen-and-its-metabolites-in-plasma-application-to-therapeutic-drug-monitoring
#17
Laurence Labat, Antonio Goncalves, Ana Rita Marques, Bénédicte Duretz, Bernard Granger, Xavier Declèves
Baclofen is actually used to manage alcohol dependence. This study describes a simple method using liquid chromatography coupled to high resolution mass spectrometry (LC-HR-MS) developed in plasma samples. This method was optimized to allow quantification of baclofen and determination of metabolic ratio of its metabolites, an oxidative deaminated metabolite of baclofen (M1) and its glucuronide form (M2). The LC-HR-MS method on Exactive® apparatus is a new developed method with all the advantages of the high resolution in full scan mode for the quantification of baclofen and detection of its metabolites in plasma...
January 14, 2017: Biomedical Chromatography: BMC
https://www.readbyqxmd.com/read/28087761/proteomics-technologies-and-their-applications
#18
REVIEW
Bilal Aslam, Madiha Basit, Muhammad Atif Nisar, Mohsin Khurshid, Muhammad Hidayat Rasool
Proteomics involves the applications of technologies for the identification and quantification of overall proteins present content of a cell, tissue or an organism. It supplements the other "omics" technologies such as genomic and transcriptomics to expound the identity of proteins of an organism, and to cognize the structure and functions of a particular protein. Proteomics-based technologies are utilized in various capacities for different research settings such as detection of various diagnostic markers, candidates for vaccine production, understanding pathogenicity mechanisms, alteration of expression patterns in response to different signals and interpretation of functional protein pathways in different diseases...
February 2017: Journal of Chromatographic Science
https://www.readbyqxmd.com/read/28087472/extract-of-clinopodium-bolivianum-protects-against-e-coli-invasion-of-uroepithelial-cells
#19
Soumitra Mohanty, Witchuda Kamolvit, Silvia Zambrana, Corine Sandström, Eduardo Gonzales, Claes-Göran Östenson, Annelie Braunerf
ETHNOPHARMACOLOGICAL RELEVANCE: Clinopodium bolivianum is a South American plant with anti-inflammatory and anti-infective activities. The increasing antibiotic resistance urges for alternative therapy. Based on its use in traditional medicine, we investigated the effect of C. bolivianum on the ability to defend bladder epithelial cells from E. coli infection. MATERIALS AND METHODS: The extract was analysed by LC-MS. Bladder epithelial cell lines T24 and 5637 and uropathogenic E...
January 10, 2017: Journal of Ethnopharmacology
https://www.readbyqxmd.com/read/28087425/variations-of-metabolites-and-proteome-in-lonicera-japonica-thunb-buds-and-flowers-under-uv-radiation
#20
Wei Zhu, Wen Zheng, Xingjiang Hu, Xiaobao Xu, Lin Zhang, Jingkui Tian
Lonicera japonica Thunb., also known as Jin Yin Hua and Japanese honeysuckle, is used as a herbal medicine in Asian countries. Its flowers have been used in folk medicine in the clinic and in making food or healthy beverages for over 1500years in China. To investigate the molecular processes involved in L. japonica development from buds to flowers exposed to UV radiation, a comparative proteomics analysis was performed. Fifty-four proteins were identified as differentially expressed, including 42 that had increased expression and 12 that had decreased expression...
January 10, 2017: Biochimica et Biophysica Acta
keyword
keyword
7289
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"