keyword
MENU ▼
Read by QxMD icon Read
search

cationic antimicrobial peptide

keyword
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#1
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29144391/antimicrobial-peptide-epinecidin-1-modulates-myd88-protein-levels-via-the-proteasome-degradation-pathway
#2
Bor-Chyuan Su, Jyh-Yih Chen
The cationic antimicrobial peptide epinecidin-1 was identified from Epinephelus coioides and possesses multiple biological functions, including antibacterial, antifungal, anti-tumor, and immunomodulatory effects. In addition, epinecidin-1 suppresses lipopolysaccharide (LPS)-induced inflammation by neutralizing LPS and ameliorating LPS/Toll-like receptor (TLR)-4 internalization. However, it is unclear whether the actions of epinecidin-1 depend on the regulation of TLR adaptor protein MyD88 or endogenous TLR signaling antagonists, which include A20, interleukin-1 receptor associated kinase (IRAK)-M, and suppressor of cytokine signaling (SOCS)-1...
November 16, 2017: Marine Drugs
https://www.readbyqxmd.com/read/29142299/the-immunomodulatory-drug-glatiramer-acetate-is-also-an-effective-antimicrobial-agent-that-kills-gram-negative-bacteria
#3
Stig Hill Christiansen, Ronan A Murphy, Kristian Juul-Madsen, Marlene Fredborg, Michael Lykke Hvam, Esben Axelgaard, Sandra M Skovdal, Rikke Louise Meyer, Uffe B Skov Sørensen, Arne Möller, Jens Randel Nyengaard, Niels Nørskov-Lauritsen, Mikala Wang, Mihaela Gadjeva, Kenneth A Howard, Jane C Davies, Eskild Petersen, Thomas Vorup-Jensen
Classic drug development strategies have failed to meet the urgent clinical needs in treating infections with Gram-negative bacteria. Repurposing drugs can lead to timely availability of new antibiotics, accelerated by existing safety profiles. Glatiramer acetate (GA) is a widely used and safe formulation for treatment of multiple sclerosis. It contains a large diversity of essentially isomeric polypeptides with the cationic and amphiphilic character of many antimicrobial peptides (AMP). Here, we report that GA is antibacterial, targeting Gram-negative organisms with higher activity towards Pseudomonas aeruginosa than the naturally-occurring AMP LL-37 in human plasma...
November 15, 2017: Scientific Reports
https://www.readbyqxmd.com/read/29141997/crispr-cas9-mediated-genome-editing-reveals-the-synergistic-effects-of-%C3%AE-defensin-family-members-on-sperm-maturation-in-rat-epididymis
#4
Chaobao Zhang, Yuchuan Zhou, Shengsong Xie, Qianqian Yin, Chunhua Tang, Zimei Ni, Jian Fei, Yonglian Zhang
The epididymis is a male reproductive organ involved in posttesticular sperm maturation and storage, but the mechanism underlying sperm maturation remains unclear. β-Defensins (Defbs) belong to a family of small, cysteine-rich, cationic peptides that are antimicrobial and modulate the immune response. A large number of Defb genes are expressed abundantly in the male reproductive tract, especially in the epididymis. We and other groups have shown the involvement of several Defb genes in regulation of sperm function...
November 15, 2017: FASEB Journal: Official Publication of the Federation of American Societies for Experimental Biology
https://www.readbyqxmd.com/read/29135264/peptide-based-polymer-polyoxometalate-supramolecular-structure-with-differed-antimicrobial-mechanism
#5
Lakshmi Priya Datta, Riya Mukherjee, Subharanjan Biswas, Tapan Kumar Das
Because of the increasing prevalence of multi-drug resistance feature, several investigations have been so far reported regarding the antibiotic alternative supramolecular bioactive agents made of hybrid assemblies. In this regard, it is well established that combinational therapy inherited by assembled supramolecular structures can improve the bioactivity to some extent but their mode of actions have not been studied in details. We provide the first direct evidence that the improved mechanism of action of antimicrobial supra-amphiphilic nanocomposites differ largely from their parent antimicrobial peptide based polymers...
November 14, 2017: Langmuir: the ACS Journal of Surfaces and Colloids
https://www.readbyqxmd.com/read/29133052/design-and-synthesis-of-short-amphiphilic-cationic-peptidomimetics-based-on-biphenyl-backbone-as-antibacterial-agents
#6
Rajesh Kuppusamy, Muhammad Yasir, Thomas Berry, Charles G Cranfield, Shashidhar Nizalapur, Eugene Yee, Onder Kimyon, Aditi Taunk, Kitty K K Ho, Bruce Cornell, Mike Manefield, Mark Willcox, David StC Black, Naresh Kumar
Antimicrobial peptides (AMPs) and their synthetic mimics have received recent interest as new alternatives to traditional antibiotics in attempts to overcome the rise of antibiotic resistance in many microbes. AMPs are part of the natural defenses of most living organisms and they also have a unique mechanism of action against bacteria. Herein, a new series of short amphiphilic cationic peptidomimetics were synthesized by incorporating the 3'-amino-[1,1'-biphenyl]-3-carboxylic acid backbone to mimic the essential properties of natural AMPs...
November 10, 2017: European Journal of Medicinal Chemistry
https://www.readbyqxmd.com/read/29127809/optimisation-of-the-antifungal-potency-of-the-amidated-peptide-h-orn-orn-trp-trp-nh2-against-food-contaminants
#7
Thibaut Thery, Yvonne O'Callaghan, Nora O'Brien, Elke K Arendt
The design of novel efficient antimicrobial peptides (AMPs) faces several issues, such as cost of synthesis, proteolytic stability or cytotoxicity. The identification of key determinants involved in the activity of AMPs, such as cationicity and amphipathicity, allowed the synthesis of short peptides with optimized properties. An ultrashort peptide made of the sequence H-Orn-Orn-Trp-Trp-NH2 (O3TR) showed antifungal activity against several contaminants from food products. This peptide inhibited the growth of the filamentous fungi Fusarium culmorum, Penicillium expansum and Aspergillus niger within a range of concentration of 12...
November 8, 2017: International Journal of Food Microbiology
https://www.readbyqxmd.com/read/29126736/synthesis-and-bioactivities-study-of-new-antibacterial-peptide-mimics-the-dialkyl-cationic-amphiphiles
#8
En Zhang, Peng-Yan Bai, De-Yun Cui, Wen-Chao Chu, Yong-Gang Hua, Qin Liu, Hai-Yang Yin, Yong-Jie Zhang, Shangshang Qin, Hong-Min Liu
The emergence of infectious diseases caused by pathogenic bacteria is widespread. Therefore, it is urgently required to enhance the development of novel antimicrobial agents with high antibacterial activity and low cytotoxicity. A series of novel dialkyl cationic amphiphiles bearing two identical length lipophilic alkyl chains and one non-peptidic amide bond were synthesized and tested for antimicrobial activities against both Gram-positive and Gram-negative bacteria. Particular compounds synthesized showed excellent antibacterial activity toward drug-sensitive bacteria such as S...
October 17, 2017: European Journal of Medicinal Chemistry
https://www.readbyqxmd.com/read/29125878/insight-into-the-interactions-residue-snorkeling-and-membrane-disordering-potency-of-a-single-antimicrobial-peptide-into-different-lipid-bilayers
#9
Majid Jafari, Faramarz Mehrnejad, Farahnoosh Doustdar
Pardaxin, with a bend-helix-bend-helix structure, is a membrane-active antimicrobial peptide that its membrane activity depends on the lipid bilayer composition. Herein, all-atom molecular dynamics (MD) simulations were performed to provide further molecular insight into the interactions, structural dynamics, orientation behavior, and cationic residues snorkeling of pardaxin in the DMPC, DPPC, POPC, POPG, POPG/POPE (3:1), and POPG/POPE (1:3) lipid bilayers. The results showed that the C-terminal helix of the peptide was maintained in all six types of the model-bilayers and pardaxin was tilted into the DMPC, DPPC, and POPG/POPE mixed bilayers more than the POPC and POPG bilayers...
2017: PloS One
https://www.readbyqxmd.com/read/29113051/antibacterial-activity-of-the-non-cytotoxic-peptide-p-bthtx-i-%C3%A2-and-its-serum-degradation-product-against-multidrug-resistant-bacteria
#10
Norival A Santos-Filho, Rafaela S Fernandes, Bruna F Sgardioli, Matheus A S Ramos, Julia P Piccoli, Ilana L B C Camargo, Tais M Bauab, Eduardo M Cilli
Antimicrobial peptides can be used systemically, however, their susceptibility to proteases is a major obstacle in peptide-based therapeutic development. In the present study, the serum stability of p-BthTX-I (KKYRYHLKPFCKK) and (p-BthTX-I)₂, a p-BthTX-I disulfide-linked dimer, were analyzed by mass spectrometry and analytical high-performance liquid chromatography (HPLC). Antimicrobial activities were assessed by determining their minimum inhibitory concentrations (MIC) using cation-adjusted Mueller-Hinton broth...
November 4, 2017: Molecules: a Journal of Synthetic Chemistry and Natural Product Chemistry
https://www.readbyqxmd.com/read/29110341/hemin-and-bile-pigments-are-the-secondary-structure-regulators-of-intrinsically-disordered-antimicrobial-peptides
#11
Ferenc Zsila, Tünde Juhász, Szilvia Bősze, Kata Horváti, Tamás Beke-Somfai
The interaction of protoporphyrin compounds of human origin with the major bee venom component melittin (26 a.a., Z +6) and its hybrid derivative (CM15, 15 a.a., Z +6) were studied by a combination of various spectroscopic methods. Throughout a two-state, concentration-dependent process, hemin and its metabolites (biliverdin, bilirubin, bilirubin ditaurate) increase the parallel β-sheet content of the natively unfolded melittin, suggesting the oligomerization of the peptide chains. In contrast, α-helix promoting effect was observed with the also disordered but more cationic CM15...
November 7, 2017: Chirality
https://www.readbyqxmd.com/read/29103131/effects-of-hydrophobic-amino-acid-substitutions-on-antimicrobial-peptide-behavior
#12
Kimberly D Saint Jean, Karlee D Henderson, Christina L Chrom, Louisa E Abiuso, Lindsay M Renn, Gregory A Caputo
Antimicrobial peptides (AMPs) are naturally occurring components of the immune system that act against bacteria in a variety of organisms throughout the evolutionary hierarchy. There have been many studies focused on the activity of AMPs using biophysical and microbiological techniques; however, a clear and predictive mechanism toward determining if a peptide will exhibit antimicrobial activity is still elusive, in addition to the fact that the mechanism of action of AMPs has been shown to vary between peptides, targets, and experimental conditions...
November 4, 2017: Probiotics and Antimicrobial Proteins
https://www.readbyqxmd.com/read/29101229/-almg-responsible-for-polymyxin-resistance-in-pandemic-v-cholerae-is-a-glycyl-transferase-distantly-related-to-lipid-a-late-acyltransferases
#13
Jeremy C Henderson, Carmen M Herrera, M Stephen Trent
Cationic antimicrobial peptides (CAMPs), such as polymyxins are used as a last-line defense in treatment of many bacterial infections. However, some bacteria have developed resistance mechanisms to survive these compounds. Current pandemic O1 Vibrio cholerae biotype El Tor is resistant to polymyxins, whereas previous pandemic strain of the classical biotype is polymyxin sensitive. The almEFG operon found in El Tor V. cholerae confers >100-fold resistance to antimicrobial peptides through aminoacylation of lipopolysaccharide (LPS), expected to decrease the negatively charged surface of the V...
November 3, 2017: Journal of Biological Chemistry
https://www.readbyqxmd.com/read/29096754/overview-of-ribosomal-and-non-ribosomal-antimicrobial-peptides-produced-by-gram-positive-bacteria
#14
M Tajbakhsh, A Karimi, F Fallah, M M Akhavan
The increasing incidence of antimicrobial resistance bacterial infection and decreasing effectiveness of conventional antibiotics to treatment have caused serious problems worldwide. The demand for new generationantibiotics to combat microbial pathogens is imperative. Cationic antimicrobial peptides (AMPs) with different sources from prokaryotic to complex eukaryotic organisms, with variable length, amino acid composition and secondary structure, have been consideredduring the past decades.  The advantages of large number of AMPs are related to broad spectrum and morphogenetic activities, low resistance rate among microorganismswithout side effect on human cells, rapid killing of bacteria via membrane damage and intracellular targets,and their critical roles in anti-inflammatory...
October 31, 2017: Cellular and Molecular Biology
https://www.readbyqxmd.com/read/29079429/antimicrobial-peptides-as-an-alternative-to-anti-tuberculosis-drugs
#15
REVIEW
Manaf AlMatar, Essam A Makky, Gülfer Yakıcı, Işıl Var, Begüm Kayar, Fatih Köksal
Tuberculosis (TB) presently accounts for high global mortality and morbidity rates, despite the introduction four decades ago of the affordable and efficient four-drugs (isoniazid, rifampicin, pyrazinamide and ethambutol). Thus, a strong need exists for new drugs with special structures and uncommon modes of action to effectively overcome M. tuberculosis. Within this scope, antimicrobial peptides (AMPs), which are small, cationic and amphipathic peptides that comprise a section of the innate immune system, are currently the leading potential agents for the treatment of TB...
October 24, 2017: Pharmacological Research: the Official Journal of the Italian Pharmacological Society
https://www.readbyqxmd.com/read/29078702/phenylalanine-residues-act-as-membrane-anchors-in-the-antimicrobial-action-of-aurein-1-2
#16
Mahdi Shahmiri, Bruce Cornell, Adam Mechler
Aurein 1.2 is a small cationic antimicrobial peptide, one of the shortest peptides that can exert antimicrobial activity at low micromolar concentrations. Aurein 1.2 is a surface acting peptide, following the "carpet" mechanism of thresholded membrane disruption. It is generally assumed that the activity of such cationic α-helical membrane disrupting peptides is charge driven. Here, the authors show that instead of charge interactions, aromatic phenylalanine residues of the Aurein 1.2 sequence facilitate the membrane binding...
October 26, 2017: Biointerphases
https://www.readbyqxmd.com/read/29066154/production-of-the-recombinant-antimicrobial-peptide-ubi18-35-in-escherichia-coli
#17
Darya O Ashcheulova, Lina V Efimova, Aliaksandr Ya Lushchyk, Aliaksei V Yantsevich, Alexander N Baikov, Alexandra G Pershina
Radiolabeled peptides derived from ubiquicidine (UBI) are of great interest for early and highly accurate scintigraphic detection and differentiation of infection and sterile inflammation. In the present work the recombinant antimicrobial peptide UBI18-35 - a fragment of the human natural cationic peptide ubiquicidine - was produced in Escherichia coli for the first time. The insoluble expression of the peptide in fusion with ketosteroid isomerase provided high yield, about 6 mg of UBI18-35 per liter. We developed an approach to produce the antimicrobial peptide UBI18-35, that encompasses inclusion body isolation and size exclusion chromatography...
October 21, 2017: Protein Expression and Purification
https://www.readbyqxmd.com/read/29051342/-68-ga-nota-functionalized-ubiquicidin-cytotoxicity-biodistribution-radiation-dosimetry-and-first-in-human-positron-emission-tomography-computed-tomography-imaging-of-infections
#18
Thomas Ebenhan, Mike Sathekge, Thabo Lenagana, Michel Koole, Olivier Gheysens, Thavendran Govender, Jan R Zeevaart
Ubiquicidin is an antimicrobial peptide (AMP) with great potential for nuclear imaging of infectious diseases as its cationic-rich fragment TGRAKRRMQYNRR (UBI) has been functionalized with 1,4,7-triazacyclononane-1,4,7-triacetic acid (NOTA) to allow complexation to Gallium-68 ((68)Ga-NOTA-UBI). We herein assess the cytotoxicity, radiation dosimetry for (68)Ga-NOTA-UBI and a first-in-human evaluation to diagnose infectious processes. Methods: Cytotoxicity was evaluated in green monkey kidney epithelial (Vero) cells and MT-4 leucocytes...
October 19, 2017: Journal of Nuclear Medicine: Official Publication, Society of Nuclear Medicine
https://www.readbyqxmd.com/read/29044929/anticancer-activity-of-vmct1-analogs-against-mcf-7-cells
#19
Cibele Nicolaski Pedron, Gislaine Patricia Andrade, Roseli Hiromi Sato, Marcelo Der Torossian Torres, Giselle Cerchiaro, Anderson Orzari Ribeiro, Vani Xavier Oliveira Junior
Antimicrobial peptides are considered promising drug candidates due to their broad range of activity. VmCT1 (Phe-Leu-Gly-Ala-Leu-Trp-Asn-Val-Ala-Lys-Ser-Val-Phe-NH2 ) is an α-helical antimicrobial peptide that was obtained from the Vaejovis mexicanus smithi scorpion venom. Some of its analogs showed to be as antimicrobial as the wild type and they were designed for understanding the influence of physiochemical parameters on antimicrobial and hemolytic activity. Some cationic antimicrobial peptides exhibit anticancer activity so VmCT1 analogs were tested in order to verify the anticancer activity of this family of peptides...
October 17, 2017: Chemical Biology & Drug Design
https://www.readbyqxmd.com/read/29040295/hydrophobic-residues-are-critical-for-the-helix-forming-hemolytic-and-bactericidal-activities-of-amphipathic-antimicrobial-peptide-tp4
#20
Ting-Wei Chang, Shu-Yi Wei, Shih-Han Wang, Hung-Mu Wei, Yu-June Wang, Chiu-Feng Wang, Chinpan Chen, You-Di Liao
Antimicrobial peptides are important components of the host innate defense mechanism against invading pathogens, especially for drug-resistant bacteria. In addition to bactericidal activity, the 25 residue peptide TP4 isolated from Nile tilapia also stimulates cell proliferation and regulates the innate immune system in mice. In this report, TP4 hyperpolarized and depolarized the membrane potential of Pseudomonas aeruginosa at sub-lethal and lethal concentrations. It also inhibited and eradicated biofilm formation...
2017: PloS One
keyword
keyword
69332
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"