keyword
MENU ▼
Read by QxMD icon Read
search

defensin

keyword
https://www.readbyqxmd.com/read/28106297/different-dynamics-and-pathway-of-disulfide-bonds-reduction-of-two-human-defensins-a-molecular-dynamics-simulation-study
#1
Liqun Zhang
Human defensins are a class of antimicrobial peptides that are crucial components of the innate immune system. Both human α defensin type 5(HD5) and human β defensin type 3 (hBD-3) have 6 cysteine residues which form 3 pairs of disulfide bonds under oxidizing condition. Disulfide bond linking is important to the protein structure stabilization, and the disulfide bond linking and breaking order has been shown to influence protein function. In this project, microsecond long molecular dynamics simulations were performed to study the structure and dynamics of HD5 and hBD-3 wildtype and analogs which have all 3 disulfide bonds released under reducing conditions...
January 20, 2017: Proteins
https://www.readbyqxmd.com/read/28105732/comparison-of-the-proliferation-and-excretion-of-bartonella-quintana-between-body-and-head-lice-following-oral-challenge
#2
J H Kim, D J Previte, K S Yoon, E Murenzi, J E Koehler, B R Pittendrigh, S H Lee, J M Clark
Human body and head lice are highly related haematophagous ectoparasites but only the body louse has been shown to transmit Bartonella quintana, the causative agent of trench fever. The mechanisms by which body lice became a vector for B. quintana, however, are poorly understood. Following oral challenge, green fluorescent protein-expressing B. quintana proliferated over 9 days postchallenge with the number of bacteria being significantly higher in whole body vs. head lice. The numbers of B. quintana detected in faeces from infected lice, however, were approximately the same in both lice...
January 20, 2017: Insect Molecular Biology
https://www.readbyqxmd.com/read/28102569/human-%C3%AE-defensin-3-increases-the-tlr9-dependent-response-to-bacterial-dna
#3
Sarah L McGlasson, Fiona Semple, Heather MacPherson, Mohini Gray, Donald J Davidson, Julia R Dorin
Human β-defensin 3 (hBD3) is a cationic antimicrobial peptide with potent bactericidal activity in vitro. HBD3 is produced in response to pathogen challenge and can modulate immune responses. The amplified recognition of self-DNA by human plasmacytoid dendritic cells has been previously reported, but we show here that hBD3 preferentially enhances the response to bacterial DNA in mouse Flt-3 induced dendritic cells (FLDCs) and in human peripheral blood mononuclear cells. We show the effect is mediated through TLR9 and although hBD3 significantly increases the cellular uptake of both E...
January 19, 2017: European Journal of Immunology
https://www.readbyqxmd.com/read/28100236/human-%C3%AE-defensin-2-production-from-s-cerevisiae-using-the-repressible-met17-promoter
#4
Thea S B Møller, Joanna Hay, Malcolm J Saxton, Karen Bunting, Evamaria I Petersen, Søren Kjærulff, Christopher J A Finnis
BACKGROUND: Baker's yeast Saccharomyces cerevisiae is a proven host for the commercial production of recombinant biopharmaceutical proteins. For the manufacture of heterologous proteins with activities deleterious to the host it can be desirable to minimise production during the growth phase and induce production late in the exponential phase. Protein expression by regulated promoter systems offers the possibility of improving productivity in this way by separating the recombinant protein production phase from the yeast growth phase...
January 18, 2017: Microbial Cell Factories
https://www.readbyqxmd.com/read/28092794/%C3%AE-defensin-3-modulates-macrophage-activation-and-orientation-during-acute-inflammatory-response-to-porphyromonas-gingivalis-lipopolysaccharide
#5
Jinglu Lyu, Tianying Bian, Bin Chen, Di Cui, Lili Li, Ling Gong, Fuhua Yan
β-defensin 3, a multifunctional antimicrobial peptide, has immuno-regulatory activities. We investigated the modulatory mechanism of human β-defensin 3 (hBD3) on acute inflammatory response resulted from Porphyromonas gingivalis lipopolysaccharide (P.g-LPS), which plays a pro-inflammatory role in periodontal infection and its derived systemic inflammation. P.g-LPS was administrated to mice and murine macrophages alone or along with hBD3. P.g-LPS could lead to acute inflammation as soon as 2h. And it was observed that hBD3 significantly decreased the production of pro-inflammatory biomarkers of in response to P...
January 13, 2017: Cytokine
https://www.readbyqxmd.com/read/28089894/determining-the-cleavage-site-for-the-mature-antimicrobial-peptide-of-nile-tilapia-%C3%AE-defensin-using-2d-electrophoresis-western-blot-and-mass-spectrometry-analysis
#6
Chin-I Chang, Li-Hao Chen, Yeh-Fang Hu, Chia-Che Wu, Jyh-Ming Tsai
Several proteomic techniques were used to determine the cleavage site of the mature antimicrobial peptide of Nile tilapia β-defensin. The computer-predicted Nile tilapia β-defensin ((25)ASFPWSCLSLSGVCRKVCLPTELFFGPLGCGKGSLCCVSHFL(66)) composed of 42 amino acids was chemically synthesized and prepared to produce an antibody for Western blotting. Total proteins from the skin of the Nile tilapia were separated on two-dimensional electrophoresis, and the spot of Nile tilapia β-defensin was recognized using Western blot analysis...
January 9, 2017: Fish & Shellfish Immunology
https://www.readbyqxmd.com/read/28089733/antimicrobial-peptide-gene-cecropin-2-and-defensin-respond-to-peptidoglycan-infection-in-the-female-adult-of-oriental-fruit-fly-bactrocera-dorsalis-hendel
#7
Shi-Huo Liu, Dong Wei, Guo-Rui Yuan, Hong-Bo Jiang, Wei Dou, Jin-Jun Wang
Cecropins and defensins are important antimicrobial peptides in insects and are inducible after injection of immune triggers. In this study, we cloned the cDNAs of two antimicrobial peptides (AMPs), cecropin-2 (BdCec-2) and defensin (BdDef) from Bactrocera dorsalis (Hendel), a serious pest causing great economic losses to fruits and vegetables. The BdCec-2 sequence of 192bp encodes a protein of 63 amino acids residues with a predicted molecular weight of 6.78 kD. The 282bp cDNA of BdDef encodes a protein of 93 residues with a predicted molecular weight of 9...
January 12, 2017: Comparative Biochemistry and Physiology. Part B, Biochemistry & Molecular Biology
https://www.readbyqxmd.com/read/28087147/immune-responses-to-in-ovo-vaccine-formulations-containing-inactivated-fowl-adenovirus-8b-with-poly-di-sodium-carboxylatoethylphenoxy-phosphazene-pcep-and-avian-beta-defensin-as-adjuvants-in-chickens
#8
Mishal Sarfraz, Muhammed Suleman, Suresh K Tikoo, Colette Wheler, Andrew A Potter, Volker Gerdts, Arshud Dar
Inclusion body hepatitis (IBH) is one of the major viral infections causing substantial economic loss to the global poultry industry. The disease is characterized by a sudden onset of mortality (2-30%) and high morbidity (60-70%). IBH is caused by a number of serotypes of fowl adenovirus with substantially low levels of serotype cross protection. Thus far, there is no effective and safe vaccine commercially available in the North America for the control of IBH in chickens. Poly[di(sodium carboxylatoethylphenoxy)]phosphazene (PCEP) is a high molecular weight, biodegradable water soluble polymer that has been well characterized as a safe and effective adjuvant for a number of experimental veterinary vaccines...
January 10, 2017: Vaccine
https://www.readbyqxmd.com/read/28081188/effect-of-varroa-destructor-wounding-and-varroa-homogenate-on-gene-expression-in-brood-and-adult-honey-bees
#9
Gun Koleoglu, Paul H Goodwin, Mariana Reyes-Quintana, Mollah Md Hamiduzzaman, Ernesto Guzman-Novoa
Honey bee (Apis mellifera) gene expression related to immunity for hymenoptaecin (AmHym) and defensin-1 (AmDef-1), longevity for vitellogenin (AmVit2) and stem cell proliferation for poly U binding factor 68 kDa (AmPuf68) was compared following Varroa destructor parasitism, buffer injection and injection of V. destructor compounds in its homogenate. In adults, V. destructor parasitism decreased expression of all four genes, while buffer injection decreased expression of AmHym, AmPuf68 and AmVit2, and homogenate injection decreased expression of AmPuf68 and AmVit2 but increased expression of AmDef-1 relative to their respective controls...
2017: PloS One
https://www.readbyqxmd.com/read/28078813/host-defense-peptide-derived-privileged-scaffolds-for-anti-infective-drug-discovery
#10
Ersilia Nigro, Irene Colavita, Daniela Sarnataro, Olga Scudiero, Aurora Daniele, Francesco Salvatore, Antonello Pessi
'Privileged scaffolds' are molecular frameworks which have been successfully exploited for small molecule drug discovery. Peptide privileged scaffolds, featuring a strictly conserved multiple-disulfide framework and high variability in the rest of the sequence, display a broad range of biological effects, including antimicrobial and antiviral activity. Unlike small molecules, however, the cost of manufacturing these peptides is high, and their synthesis challenging. We previously described a simplified privileged scaffold corresponding to the γ-core of human β-defensin-3 (HBD3)...
January 12, 2017: Journal of Peptide Science: An Official Publication of the European Peptide Society
https://www.readbyqxmd.com/read/28077642/studies-on-the-interaction-of-tumor-derived-hd5-alpha-defensins-with-adenoviruses-and-implications-for-oncolytic-adenovirus-therapy
#11
Charles Vragniau, Jens-Martin Hübner, Peter Beidler, Sucheol Gil, Kamola Saydaminova, Zhuo-Zhuang Lu, Roma Yumul, Hongjie Wang, Maximilian Richter, Pavel Sova, Charles Drescher, Pascal Fender, André Lieber
: Defensins are small anti-microbial peptides capable of neutralizing human adenovirus (HAdV) in vitro by binding capsid proteins and blocking endosomal escape of virus. In humans, the alpha defensin HD5 is produced by specialized epithelial cells of the gastro-intestinal and genito-urinary tracts. Here we demonstrate that HD5 is also expressed as an active, secreted peptide by epithelial ovarian and lung cancer cells in situ, in patient biopsies. This finding triggered us to study the role of HD5 in infection and spread of replication-competent, oncolytic HAdV type 3 virus...
January 11, 2017: Journal of Virology
https://www.readbyqxmd.com/read/28069432/microrna-expression-changes-after-lipopolysaccharide-treatment-in-gills-of-amphioxus-branchiostoma-belcheri
#12
Xin Liao, Liu Yang, Qilin Zhang, Junyuan Chen
Recently, amphioxus has served as a model for studying the origin and evolution of vertebrate immunity. However, little is known about how microRNAs (miRNAs) are involved in the immune defense in amphioxus. In this article, we identified the amphioxus miRNAs in the acute-phase response to lipopolysaccharide (LPS). We determined the time point for the peak of immune response in amphioxus after LPS challenge by evaluating the expression of Branchiostoma belcheri toll-like receptor 1, NF-κb (c-Rel), and big defensin which react with pathogen-associated molecular patterns(PAMPs)...
January 6, 2017: Developmental and Comparative Immunology
https://www.readbyqxmd.com/read/28067516/elucidating-the-bacterial-membrane-disruption-mechanism-of-human-%C3%AE-defensin-5-a-theoretical-study
#13
Sang Won Jung, Juho Lee, Art E Cho
Human α-defensin 5 (HD5) is a broad-spectrum antibacterial peptide produced by small intestinal Paneth cells. Despite considerable experimental evidence for the correlation between bacterial membrane destruction and the antibacterial activity of HD5, its membrane disruption mechanism remains unclear. Using all-atom molecular dynamics (MD) simulations and molecular mechanics Poisson-Boltzmann surface area (MM-PBSA) analysis, we demonstrate the membrane disruption mechanism of HD5 based on the intrinsic binding of HD5 to Gram-negative (GN) bacterial inner-membrane...
January 9, 2017: Journal of Physical Chemistry. B
https://www.readbyqxmd.com/read/28067065/the-investigation-of-antimicrobial-peptides-expression-and-its-related-interaction-with-methotrexate-treatment-in-patients-with-psoriasis-vulgaris
#14
Emin Ozlu, Ayse Serap Karadag, Seyma Ozkanli, Serpil Oguztuzun, Ozge Akbulak, Tugba Kevser Uzuncakmak, Serkan Demirkan, Necmettin Akdeniz
BACKGROUND: Psoriasis is a chronic, inflammatory and immune-mediated disease. Recently, the role of antimicrobial peptides (AMPs) such as human beta defensins (hBDs) in the pathogenesis of psoriasis has been investigated. We aimed to evaluate the expression profiles of hBD-1 and hBD-2 in psoriatic skin before and after methotrexate (MTX) therapy and to compare healthy controls. METHODS: Immunohistochemical expressions of hBD-1 and hBD-2 were assessed in 16 patients with psoriasis vulgaris and 20 normal skin biopsies from healthy controls...
January 8, 2017: Cutaneous and Ocular Toxicology
https://www.readbyqxmd.com/read/28053259/qualitative-%C3%AE-defensin-test-synovasure-for-the-diagnosis-of-periprosthetic-infection-in-revision-total-joint-arthroplasty
#15
I K Sigmund, J Holinka, J Gamper, K Staats, C Böhler, B Kubista, R Windhager
AIMS: The diagnosis of periprosthetic joint infection (PJI) remains demanding due to limitations of all the available diagnostic tests. The synovial fluid marker, α-defensin, is a promising adjunct for the assessment of potential PJI. The purpose of this study was to investigate the qualitative assessment of α-defensin, using Synovasure to detect or exclude periprosthetic infection in total joint arthroplasty. PATIENTS AND METHODS: We studied 50 patients (28 women, 22 men, mean age 65 years; 20 to 89) with a clinical indication for revision arthroplasty who met the inclusion criteria of this prospective diagnostic study...
January 2017: Bone & Joint Journal
https://www.readbyqxmd.com/read/28042275/the-level-of-beta-defensin-2-in-saliva-and-its-expression-in-parotid-gland-epithelial-cells-after-probiotic-lactobacillus-reuteri-induction-to-inhibit-streptococcus-mutans-in-caries
#16
Tuti Kusumaningsih, M S Subijanto, Retno Indrawati, R Rini Devijanti
OBJECTIVE: The aim of this study was to prove that administrating L. reuteri probiotics can increase the level of BD-2 saliva and BD-2 expression in the epithelial parotid glands of Wistar rats. MATERIALS AND METHODS: Experimental design in this study was randomized control group post test only. Twenty-four white male Rattus norvegicus Wistar strain rats were divided into four groups. The negative control group included rats not induced by S. mutans whereas the positive control group included rats induced by S...
October 2016: European Journal of Dentistry
https://www.readbyqxmd.com/read/28038935/defense-peptide-repertoire-of-stellaria-media-predicted-by-high-throughput-next-generation-sequencing
#17
Anna A Slavokhotova, Andrey A Shelenkov, Tatyana V Korostyleva, Eugene A Rogozhin, Nataliya V Melnikova, Anna V Kudryavtseva, Tatyana I Odintsova
Being perfectly adapted to diverse environments, chickweed (Stellaria media (L.) Vill), a ubiquitous garden weed, grows widely in Europe and North America. As opposed to the model plants, many weeds, and S. media in particular, have been poorly studied, although they are likely to contain promising components of immunity and novel resistance genes. In this study, for the first time RNA-seq analysis of healthy and infected with Fusarium oxysporum chickweed seedlings, as well as de novo transcriptome assembly and annotation, are presented...
December 27, 2016: Biochimie
https://www.readbyqxmd.com/read/28032328/targeting-exogenous-%C3%AE-defensin-to-the-endolysosomal-compartment-via-a-vehicle-guided-system
#18
Lorena Carvelli, Yuan Libin, Sherry Esfandnia, Yan Zhang, John F Presley, Carlos R Morales
A number of pathogens for which there are no effective treatments infect the cells via endocytosis. Once in the endosomes, the pathogens complete their life cycle by overriding normal lysosomal functions. Recently, our laboratory identified the lysosomal targeting signal of prosaposin, which is recognized by the sorting receptor "sortilin". Based on this evidence, we tested whether the antimicrobial peptide β-Defensin linked to the targeting sequence of prosaposin (βD-PSAP) could be redirected from its secretory pathway to the endolysosomal compartment...
December 29, 2016: Histology and Histopathology
https://www.readbyqxmd.com/read/28029648/genomic-differences-between-black-and-white-patients-implicate-a-distinct-immune-response-to-papillary-renal-cell-carcinoma
#19
David J Paulucci, John P Sfakianos, Anders J Skanderup, Kathleen Kan, Che-Kai Tsao, Matthew D Galsky, A Ari Hakimi, Ketan K Badani
Significant disparities in survival, incidence and possibly response to current therapies exist between black and white patients with renal cell carcinoma (RCC). Recent genomic evidence to account for these disparities has been reported for clear cell RCC. However, racial disparities at the genomic level for papillary RCC (pRCC) which is a genetically distinct and less responsive histologic subtype of RCC have not been reported. Using The Cancer Genome Atlas (TCGA) data, the present study assessed gene-level expression, somatic mutation and pathway differences between 58 black and 58 white patients with pRCC propensity matched on age, gender and pathologic T stage...
December 23, 2016: Oncotarget
https://www.readbyqxmd.com/read/28026958/human-%C3%AE-defensin-6-self-assembly-prevents-adhesion-and-suppresses-virulence-traits-of-candida-albicans
#20
Phoom Chairatana, I-Ling Chiang, Elizabeth M Nolan
HD6 is a host-defense peptide that contributes to intestinal innate immunity and mediates homeostasis at mucosal surfaces by forming non-covalent oligomers that capture bacteria and prevent bacterial invasion into the epithelium. Our present work illustrates a new role of HD6 in defending the host epithelium against pathogenic microorganisms. We report that HD6 blocks Candida albicans adhesion to human intestinal epithelial cells and suppresses two C. albicans virulence traits, namely invasion into human epithelial cells and biofilm formation...
December 27, 2016: Biochemistry
keyword
keyword
68026
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"