keyword
MENU ▼
Read by QxMD icon Read
search

Pseudomonas aeruginosa

keyword
https://www.readbyqxmd.com/read/29150484/correction-for-bortolotti-et-al-pseudomonas-aeruginosa-quorum-sensing-molecule-n-3-oxododecanoyl-l-homoserine-lactone-induces-hla-g-expression-in-human-immune-cells
#1
Daria Bortolotti, Joel LeMaoult, Claudio Trapella, Dario Di Luca, Edgardo D Carosella, Roberta Rizzo
No abstract text is available yet for this article.
December 2017: Infection and Immunity
https://www.readbyqxmd.com/read/29150357/caregiver-burden-of-parents-of-young-children-with-cystic-fibrosis
#2
C Fitzgerald, S George, R Somerville, B Linnane, P Fitzpatrick
BACKGROUND: There is a paucity of research examining the impact of informal caregiving on parents of young children with cystic fibrosis (CF). The aim of this study was to examine caregiver burden and identify risk factors associated with high caregiver burden in mothers and fathers of young children with CF. METHODS: This was a cross-sectional study of parents of young children with CF. A total of 213 families were invited to complete the CarerQoL questionnaire, a validated tool composed of two parts: (i) the CarerQol-7D which describes the care situation in terms of the negative and positive effects of caregiving and (ii) the visual analogue scale (VAS) which measures happiness on a scale from 0 to 10 (0=completely unhappy and 10=completely happy)...
November 14, 2017: Journal of Cystic Fibrosis: Official Journal of the European Cystic Fibrosis Society
https://www.readbyqxmd.com/read/29149978/perioperative-prophylaxis-for-total-artificial-heart-transplantation
#3
H E Chambers, P Pelish, F Qiu, D F Florescu
BACKGROUND: Practice variation regarding perioperative antimicrobial prophylaxis in total artificial heart transplantations (TAH-t) across institutions is unknown. The aim of our survey was to assess the current practices for prevention of infection in TAH-t recipients among different programs. METHODS: An electronic survey was sent to programs that implant Syncardia TAH (Syncardia Systems, Tuscon, Ariz, USA). Proportions were analyzed for categorical variables; means and SDs were analyzed for continuous variables...
November 2017: Transplantation Proceedings
https://www.readbyqxmd.com/read/29149337/mechanisms-leading-to-in-vivo-ceftolozane-tazobactam-resistance-development-during-the-treatment-of-infections-caused-by-mdr-pseudomonas-aeruginosa
#4
Pablo A Fraile-Ribot, Gabriel Cabot, Xavier Mulet, Leonor Periañez, M Luisa Martín-Pena, Carlos Juan, José L Pérez, Antonio Oliver
Objectives: Characterization of the mechanisms driving ceftolozane/tazobactam resistance development in 5 of 47 (10.6%) patients treated for MDR Pseudomonas aeruginosa infections in a Spanish hospital. Methods: Five pairs of ceftolozane/tazobactam-susceptible/resistant P. aeruginosa isolates were studied. MICs were determined by broth microdilution, clonal relatedness was assessed by MLST and resistance mechanisms were investigated by phenotypic and genotypic methods, including WGS...
November 14, 2017: Journal of Antimicrobial Chemotherapy
https://www.readbyqxmd.com/read/29149302/activity-of-colistin-alone-or-in-combination-with-rifampicin-or-meropenem-in-a-carbapenem-resistant-bioluminescent-pseudomonas-aeruginosa-intraperitoneal-murine-infection-model
#5
Yun Cai, Deqing Yang, Jin Wang, Rui Wang
Background: Carbapenem-resistant Pseudomonas aeruginosa (CRPA) infections represent a major therapeutic problem and combination therapy may be the chemotherapeutic option. Methods: Bioluminescent CRPA was developed through sequential subcultures in subinhibitory concentrations of meropenem from an engineered strain of bioluminescent PA Xen5. Then CRPA was injected intraperitoneally to establish an intraperitoneal murine infection model. Treatments of colistin alone or combined with rifampicin or meropenem were started 1 h after infection...
November 14, 2017: Journal of Antimicrobial Chemotherapy
https://www.readbyqxmd.com/read/29149019/incidence-and-consequences-of-near-drowning-related-pneumonia-a-descriptive-series-from-martinique-french-west-indies
#6
Laura Cerland, Bruno Mégarbane, Hatem Kallel, Yanick Brouste, Hossein Mehdaoui, Dabor Resiere
Drowning represents one major cause of accidental death. Near-drowning patients are exposed to aspiration that may result in pneumonia with life-threatening consequences. We designed this descriptive study to investigate the frequency, nature, and consequences of post-drowning pneumonia. One hundred and forty-four near-drowning patients (33 children and 111 adults) admitted during four years to the University Hospital of Martinique, French Indies, were included. Patients presented pre-hospital cardiac arrest (41%) and exhibited acute respiratory failure (54%), cardiovascular failure (27%), and lactic acidosis (75%) on admission...
November 17, 2017: International Journal of Environmental Research and Public Health
https://www.readbyqxmd.com/read/29147502/chemical-space-guided-discovery-of-antimicrobial-bridged-bicyclic-peptides-against-pseudomonas-aeruginosa-and-its-biofilms
#7
Ivan Di Bonaventura, Xian Jin, Ricardo Visini, Daniel Probst, Sacha Javor, Bee-Ha Gan, Gaëlle Michaud, Antonino Natalello, Silvia Maria Doglia, Thilo Köhler, Christian van Delden, Achim Stocker, Tamis Darbre, Jean-Louis Reymond
Herein we report the discovery of antimicrobial bridged bicyclic peptides (AMBPs) active against Pseudomonas aeruginosa, a highly problematic Gram negative bacterium in the hospital environment. Two of these AMBPs show strong biofilm inhibition and dispersal activity and enhance the activity of polymyxin, currently a last resort antibiotic against which resistance is emerging. To discover our AMBPs we used the concept of chemical space, which is well known in the area of small molecule drug discovery, to define a small number of test compounds for synthesis and experimental evaluation...
October 1, 2017: Chemical Science
https://www.readbyqxmd.com/read/29147117/colistin-resistance-of-pseudomonas-aeruginosa-isolated-from-snakes-in-taiwan
#8
Po-Yu Liu, Ling-Ling Weng, Shu-Ying Tseng, Chou-Chen Huang, Ching-Chang Cheng, Yan-Chiao Mao, Kwong-Chung Tung
This study included fifty-eight isolates of P. aeruginosa from the oral cavity of snakes that were recruited from clinical cases, captive and wild snakes. The minimum inhibitory concentrations (MICs) for the determination of susceptibility were identified by the broth microdilution method. Polymerase chain reaction (PCR) was employed to detect β-lactamases genes. With regard to antipseudomonal antibiotics, the lowest nonsusceptible rates were in aztreonam (15%), piperacillin/tazobactam (12%), and amikacin (9%)...
2017: Canadian Journal of Infectious Diseases & Medical Microbiology
https://www.readbyqxmd.com/read/29146840/draft-genome-sequence-of-the-mucoid-pseudomonas-aeruginosa-clinical-isolate-pa34
#9
Lucas B Harrison, Nancy D Hanson
Pseudomonas aeruginosa is a serious threat to patients suffering from cystic fibrosis. These organisms are exposed to a unique set of selective pressures within the lung. Here, we report the draft genome sequence of a mucoid P. aeruginosa clinical isolate obtained from a cystic fibrosis patient colonized with P. aeruginosa.
November 16, 2017: Genome Announcements
https://www.readbyqxmd.com/read/29146598/structural-analyses-unravel-the-molecular-mechanism-of-cyclic-di-gmp-regulation-of-bacterial-chemotaxis-via-a-pilz-adaptor-protein
#10
Xin-Fu Yan, Lingyi Xin, Jackie Tan Yen, Yukai Zeng, Shengyang Jin, Qing Wei Cheang, Rachel Andrea Chea Yuen Fong, Keng-Hwee Chiam, Zhao-Xun Liang, Yong-Gui Gao
The bacterial second messenger cyclic di-GMP (c-di-GMP) has emerged as a prominent mediator of bacterial physiology, motility and pathogenicity. Cdi-GMP often regulates the function of its protein targets through a unique mechanism that involves a discrete PilZ adaptor protein. However, the molecular mechanism in c-di-GMP-mediated protein regulation is unclear. Here, we present the structure of the PilZ adaptor protein MapZ co-crystallized in complex with c-di-GMP and its protein target CheR1, a chemotaxis-regulating methyltransferase in Pseudomonas aeruginosa This co-crystal structure, together with the structure of free CheR1, revealed that the binding of c-di-GMP induces dramatic structural changes in MapZ that are crucial for CheR1 binding...
November 16, 2017: Journal of Biological Chemistry
https://www.readbyqxmd.com/read/29146575/lumacaftor-vx-809-restores-the-ability-of-cf-macrophages-to-phagocytose-and-kill-pseudomonas-aeruginosa
#11
Roxanna Barnaby, Katja Koeppen, Amanda Nymon, Thomas H Hampton, Brent Berwin, Alix Ashare, Bruce Stanton
Cystic Fibrosis (CF), the most common lethal genetic disease in Caucasians, is characterized by chronic bacterial lung infection and excessive inflammation, which leads to progressive loss of lung function, and premature death. Although ivacaftor (VX-770) and the combination of ivacaftor and lumacaftor (VX-809) improve lung function in CF patients with the Gly551Asp and del508Phe mutation, respectively, the effects of these drugs on the function of human CF macrophages are unknown. Thus, studies were conducted to examine the effects of lumacaftor alone and in combination with ivacaftor (i...
November 16, 2017: American Journal of Physiology. Lung Cellular and Molecular Physiology
https://www.readbyqxmd.com/read/29146549/risk-assessment-of-infected-children-with-pseudomonas-aeruginosa-pneumonia-by-combining-host-and-pathogen-predictors
#12
Jiayi Chen, Yuhang Chen, Pengwei Hu, Tao Zhou, Xin Xu, Xiaofang Pei
The current criteria of pneumonia severity, which mainly depend on clinical manifestations and laboratory findings from blood routine tests and X-ray examination, are still of great significance in preliminary diagnosis. However, the utility of traditional severe pneumonia indexes (SPI) without considering high virulence and multidrug resistance of Pseudomonas aeruginosa has limitations. Thus, it is of great value to make a risk assessment, which can serve as a complementary option for incomplete clinical diagnosis...
November 13, 2017: Infection, Genetics and Evolution
https://www.readbyqxmd.com/read/29146531/specific-oxygenation-of-plasma-membrane-phospholipids-by-pseudomonas-aeruginosa-lipoxygenase-induces-structural-and-functional-alterations-in-mammalian-cells
#13
Maceler Aldrovandi, Swathi Banthiya, Sven Meckelmann, You Zhou, Dagmar Heydeck, Valerie B O'Donnell, Hartmut Kuhn
Pseudomonas aeruginosa is a gram-negative pathogen, which causes life-threatening infections in immunocompromized patients. These bacteria express a secreted lipoxygenase (PA-LOX), which oxygenates free arachidonic acid to 15S-hydro(pero)xyeicosatetraenoic acid. It binds phospholipids at its active site and physically interacts with lipid vesicles. When incubated with red blood cells membrane lipids are oxidized and hemolysis is induced but the structures of the oxygenated membrane lipids have not been determined...
November 13, 2017: Biochimica et Biophysica Acta
https://www.readbyqxmd.com/read/29146498/synthesis-and-characterization-of-silver-nanoparticles-using-gelidium-amansii-and-its-antimicrobial-property-against-various-pathogenic-bacteria
#14
Arivalagan Pugazhendhi, Desika Prabakar, Jaya Mary Jacob, Indira Karuppusamy, Rijuta Ganesh Saratale
Microfouling is evolving at a fast rate causing augmented mortality rates and damage worldwide. Until now, several remedial measures have been exploited to overcome microfouling, amongst them nanoparticles play a superior role. Currently, green synthesized nanoparticles have been centered owing to its eco-friendly, cost effectively and non-toxic nature which has also increased its industrial applications (biomedicine, food and textile). In the present research Silver Nanoparticles (Ag NPs) synthesized using marine red algae Gelidium amansii...
November 13, 2017: Microbial Pathogenesis
https://www.readbyqxmd.com/read/29146265/sawr-a-new-regulator-controlling-pyomelanin-synthesis-in-pseudomonas-aeruginosa
#15
Yossi Ben-David, Elena Zlotnik, Itzhak Zander, Gal Yerushalmi, Sivan Shoshani, Ehud Banin
Surface Acoustic Waves (SAW) were previously shown to inhibit biofilm formation, increase bacterial susceptibility to antibiotic treatment and alter the transcription pattern of Pseudomonas aeruginosa. Here we characterize one gene, sawR (PA3133), that is highly overexpressed when P. aeruginosa is exposed to SAW. SawR is a putative transcription factor belonging to the TetR regulator family. When overexpressed sawR causes numerous phenotypes, including the accumulation of a brown pigment which we identified as pyomelanin...
January 2018: Microbiological Research
https://www.readbyqxmd.com/read/29146259/characterization-and-assessment-of-two-biocontrol-bacteria-against-pseudomonas-syringae-wilt-in-solanum-lycopersicum-and-its-genetic-responses
#16
Kaliannan Durairaj, Palanivel Velmurugan, Jung-Hee Park, Woo-Suk Chang, Yool-Jin Park, Palaninaicker Senthilkumar, Kyung-Min Choi, Jeong-Ho Lee, Byung-Taek Oh
Pseudomonas and Bacillus species are attractive due to their potential bio-control application against plant bacterial pathogens. Pseudomonas aeruginosa strain D4 and Bacillus stratosphericus strain FW3 were isolated from mine tailings in South Korea. In these potent bacterial strains, we observed improved antagonistic activity against Pseudomonas syringae DC3000. These strains produced biocatalysts for plant growth promotion, and in vivo examination of Solanum lycopersicum included analysis of disease severity, ion leakage, chlorophyll content, and H2O2 detection...
January 2018: Microbiological Research
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#17
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29143505/-inhaled-antibiotics-for-the-management-of-non-cystic-fibrosis-bronchiectasis
#18
Gregory Berra, Émilie Chappuis-Gisin, Paola M Soccal, Jérôme Plojoux
Bronchiectasis is irreversible bronchial dilatation associated with chronic respiratory symptoms. Management is aimed at reducing symptoms and slowing the progression of the disease by interrupting the vicious circle: bronchial infection, inflammation, altered mucociliary clearance, lung destruction. Unlike the literature on inhaled antibiotics in cystic fibrosis, literature data are limited and of low quality for bronchiectasis of other causes. However, new recommendations from the European Respiratory Society propose the conditional use of inhaled antibiotics to prevent repeated infectious exacerbations and to eradicate Pseudomonas aeruginosa colonization...
November 15, 2017: Revue Médicale Suisse
https://www.readbyqxmd.com/read/29143238/yeasts-and-bacterial-biosurfactants-as-demulsifiers-for-petroleum-derivative-in-seawater-emulsions
#19
Fernanda Cristina P Rocha E Silva, Bruno Augusto C Roque, Nathalia Maria P Rocha E Silva, Raquel D Rufino, Juliana M Luna, Valdemir A Santos, Ibrahim M Banat, Leonie A Sarubbo
Oil sludge or waste generated in transport, storage or refining forms highly stable mixtures due to the presence and additives with surfactant properties and water forming complex emulsions. Thus, demulsification is necessary to separate this residual oil from the aqueous phase for oil processing and water treatment/disposal. Most used chemical demulsifiers, although effective, are environmental contaminants and do not meet the desired levels of biodegradation. We investigated the application of microbial biosurfactants as potential natural demulsifiers of petroleum derivatives in water emulsions...
November 15, 2017: AMB Express
https://www.readbyqxmd.com/read/29142383/assessment-of-doripenem-meropenem-and-imipenem-against-respiratory-isolates-of-pseudomonas-aeroginosa-in-a-tertiary-care-hospital-of-north-india
#20
Arti Negi, Mridu Anand, Avinash Singh, Awadhesh Kumar, Chinmoy Sahu, Kashi Nath Prasad
Objective: Pseudomonas aeruginosa is one of the leading pathogen causing healthcare-associated infections, particularly in immunocompromised and critically ill patients. The development of carbapenem resistance in P. aeruginosa infections is worrisome. Data specifically comparing the susceptibility of the three available carbapenems are lacking in the Indian subcontinent. Materials and Methods: We evaluated the minimum inhibitory concentrations (MICs) of the three commonly used carbapenems- imipenem, meropenem, and doripenem against, 435 P...
October 2017: Indian Journal of Critical Care Medicine
keyword
keyword
6046
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"