keyword
MENU ▼
Read by QxMD icon Read
search

Antibacterial agents

keyword
https://www.readbyqxmd.com/read/27913897/rainbow-trout-oncorhynchus-mykiss-pro-oxidant-and-genotoxic-responses-following-acute-and-chronic-exposure-to-the-antibiotic-oxytetracycline
#1
Sara Rodrigues, Sara C Antunes, Alberto T Correia, Bruno Nunes
Oxytetracycline (OTC), an antibacterial agent, is extensively used in aquaculture practices all over the world, but also in human and veterinary medicines. Because of its intensive use, low rates of absorption by treated animals, inadequate disposal, and low efficiency of removal in wastewater treatment plants, the potential harmful effects on aquatic organisms are of great concern. This work aimed to assess the effects of this antibiotic in rainbow trout, following both acute and chronic exposures. Catalase (CAT), total glutathione peroxidase (GPx), glutathione reductase (GRed) activities and lipid peroxidation (TBARS levels) were quantified as oxidative stress biomarkers, in gills and liver...
December 2, 2016: Ecotoxicology
https://www.readbyqxmd.com/read/27912884/synergism-of-coumarins-from-the-chinese-drug-zanthoxylum-nitidum-with-antibacterial-agents-against-methicillin-resistant-staphylococcus-aureus-mrsa
#2
Guo-Ying Zuo, Chun-Juan Wang, Jun Han, Yu-Qing Li, Gen-Chun Wang
BACKGROUND: Methicillin-resistant Staphylococcus aureus (MRSA) poses a serious therapeutic challenge in current clinic and new drug development. Natural coumarins have diverse bioactivities and the potential of resistance modifying effects. PURPOSE: This study is to present in-depth evaluations of in vitro antimicrobial activities of four natural coumarins 5-geranyloxy-7-methoxycoumarin (Gm, 1), (5,7-dimethoxy-8-prenyloxycoumarin (artanin, Ar, 2)), isopimpinellin (Is, 3) and phellopterin (Ph, 4) from Zanthoxylum nitidum (Roxb...
December 15, 2016: Phytomedicine: International Journal of Phytotherapy and Phytopharmacology
https://www.readbyqxmd.com/read/27911430/-clinical-presentations-of-herpes-zoster-ophthalmicus-diagnosis-and-therapy
#3
G M Chernakova, E A Kleshcheva, T B Semenova
: Approximately a quarter of the world's population at some point in life is at risk of developing shingles (Herpes Zoster). In 10-20% of cases the first branch of the trigeminal nerve gets involved (Herpes Zoster Ophthalmicus, HZO). Ophthalmic complications of HZO are able to cause a significant reduction in visual function. AIM: To study and summarize clinical features of HZO (including the rate of complications and their nature) and to determine the relationship between clinical and laboratory data from these patients...
2016: Vestnik Oftalmologii
https://www.readbyqxmd.com/read/27908256/a-review-on-nano-antimicrobials-metal-nanoparticles-methods-and-mechanisms
#4
Edris Hoseinzadeh, Pouran Makhdoumi, Parisa Taha, John Stelling, Hooshyar Hossini, Mohammad Amjad Kamal, Ghulam Md Ashraf
Nanotechnology is a scientific and engineering technology conducted at the Nano-scale, such as in the fields of compound fabric manufacturing, food processing, agricultural processing, and engineering, as well as in medical and medicinal application. In recent decade, nanomaterial applications for antimicrobial works have been interested by many researchers. Available reports show that some of the metal oxide Nanoparticles including; Al2O3, TiO2, ZnO, CuO, Co3O4, In2O3, MgO, SiO2, ZrO2, Cr2O3, Ni2O3, Mn2O3, CoO, and Nickel oxide have toxicity toward several microorganisms and they could successfully kill numerous bacteria...
December 1, 2016: Current Drug Metabolism
https://www.readbyqxmd.com/read/27907189/structural-insights-into-streptococcal-competence-regulation-by-the-cell-to-cell-communication-system-comrs
#5
Antoine Talagas, Laetitia Fontaine, Laura Ledesma-Garca, Johann Mignolet, Inès Li de la Sierra-Gallay, Noureddine Lazar, Magali Aumont-Nicaise, Michael J Federle, Gerd Prehna, Pascal Hols, Sylvie Nessler
In Gram-positive bacteria, cell-to-cell communication mainly relies on extracellular signaling peptides, which elicit a response either indirectly, by triggering a two-component phosphorelay, or directly, by binding to cytoplasmic effectors. The latter comprise the RNPP family (Rgg and original regulators Rap, NprR, PrgX and PlcR), whose members regulate important bacterial processes such as sporulation, conjugation, and virulence. RNPP proteins are increasingly considered as interesting targets for the development of new antibacterial agents...
December 2016: PLoS Pathogens
https://www.readbyqxmd.com/read/27907048/chemical-defence-in-a-millipede-evaluation-and-characterization-of-antimicrobial-activity-of-the-defensive-secretion-from-pachyiulus-hungaricus-karsch-1881-diplopoda-julida-julidae
#6
Slaviša Stanković, Ivica Dimkić, Ljubodrag Vujisić, Sofija Pavković-Lučić, Zvezdana Jovanović, Tatjana Stević, Ivana Sofrenić, Bojan Mitić, Vladimir Tomić
The chemical defence of the millipede Pachyiulus hungaricus is reported in the present paper, in which a chemical characterization is given and antimicrobial activity is determined. In total, independently of sex, 44 compounds were identified. All compounds belong to two groups: quinones and pentyl and hexyl esters of long-chain fatty acids. The relative abundances of quinones and non-quinones were 94.7% vs. 5.3% (males) and 87.3% vs. 12.7% (females), respectively. The two dominant quinones in both sexes were 2-methyl-1,4,-benzoquinone and 2-methoxy-3-methyl-1,4-benzoquinone...
2016: PloS One
https://www.readbyqxmd.com/read/27906147/biogenic-synthesis-of-silver-nanoparticles-from-cassia-fistula-linn-in-vitro-assessment-of-their-antioxidant-antimicrobial-and-cytotoxic-activities
#7
Yugal Kishore Mohanta, Sujogya Kumar Panda, Kunal Biswas, Abiral Tamang, Jaya Bandyopadhyay, Debashis De, Dambarudhar Mohanta, Akshaya Kumar Bastia
The present study reports on biogenic-synthesised silver nanoparticles (AgNPs) derived by treating Ag ions with an extract of Cassia fistula leaf, a popular Indian medicinal plant found in natural habitation. The progress of biogenic synthesis was monitored time to time using a ultraviolet-visible spectroscopy. The effect of phytochemicals present in C. fistula including flavonoids, tannins, phenolic compounds and alkaloids on the homogeneous growth of AgNPs was investigated by Fourier-transform infrared spectroscopy...
December 2016: IET Nanobiotechnology
https://www.readbyqxmd.com/read/27906136/rapid-synthesis-of-silver-nanoparticles-by-pseudomonas-stutzeri-isolated-from-textile-soil-under-optimised-conditions-and-evaluation-of-their-antimicrobial-and-cytotoxicity-properties
#8
Nishant Rajora, Sanket Kaushik, Anupam Jyoti, Shanker L Kothari
Present study utilised textile soil isolated bacterium Pseudomonas stutzeri to synthesise extracellular silver nanoparticles (AgNPs) under optimised conditions. The synthesised AgNPs were characterised using ultraviolet-visible spectroscopy, Fourier transform infrared spectroscopy (FTIR) and transmission electron microscopy (TEM). Optimisation showed AgNPs synthesis within 8 h using 2mM Ag nitrate at pH9, temperature 80°C and maximum absorbance toward 400 nm. TEM analysis revealed spherical shape AgNPs and reduction in size upto 8 nm was observed under optimised conditions...
December 2016: IET Nanobiotechnology
https://www.readbyqxmd.com/read/27905994/the-role-of-il-10-in-mycobacterium-avium-subsp-paratuberculosis-infection
#9
REVIEW
Tariq Hussain, Syed Zahid Ali Shah, Deming Zhao, Srinand Sreevatsan, Xiangmei Zhou
Mycobacterium avium subsp. paratuberculosis (MAP) is an intracellular pathogen and is the causative agent of Johne's disease of domestic and wild ruminants. Johne's disease is characterized by chronic granulomatous enteritis leading to substantial economic losses to the livestock sector across the world. MAP persistently survives in phagocytic cells, most commonly in macrophages by disrupting its early antibacterial activity. MAP triggers several signaling pathways after attachment to pathogen recognition receptors (PRRs) of phagocytic cells...
December 1, 2016: Cell Communication and Signaling: CCS
https://www.readbyqxmd.com/read/27904526/new-agents-approved-for-treatment-of-acute-staphylococcal-skin-infections
#10
Jan Tatarkiewicz, Anna Staniszewska, Magdalena Bujalska-Zadrożny
Vancomycin has been a predominant treatment for methicillin-resistant Staphylococcus aureus (MRSA) infections for decades. However, growing reservations about its efficacy led to an urgent need for new antibiotics effective against MRSA and other drug-resistant Staphylococcus aureus strains. This review covers three new anti-MRSA antibiotics that have been recently approved by the FDA: dalbavancin, oritavancin, and tedizolid. The mechanism of action, indications, antibacterial activity profile, microbial resistance, pharmacokinetics, clinical efficacy, adverse effects, interactions as well as available formulations and administration of each of these new antibiotics are described...
December 1, 2016: Archives of Medical Science: AMS
https://www.readbyqxmd.com/read/27901105/photodegradation-of-organic-pollutants-rhb-dye-using-uv-simulated-sunlight-on-ceria-based-tio2-nanomaterials-for-antibacterial-applications
#11
Kaviyarasu Kasinathan, John Kennedy, Manikandan Elayaperumal, Mohamed Henini, Maaza Malik
To photo-catalytically degrade RhB dye using solar irradiation, CeO2 doped TiO2 nanocomposites were synthesized hydrothermally at 700 °C for 9 hrs. All emission spectra showed a prominent band centered at 442 nm that was attributed to oxygen related defects in the CeO2-TiO2 nanocrystals. Two sharp absorption bands at 1418 cm(-1) and 3323 cm(-1) were attributed to the deformation and stretching vibration, and bending vibration of the OH group of water physisorbed to TiO2, respectively. The photocatalytic activities of Ce-TiO2 nanocrystals were investigated through the degradation of RhB under UV and UV+ visible light over a period of 8 hrs...
November 30, 2016: Scientific Reports
https://www.readbyqxmd.com/read/27900434/combination-of-microbiological-spectroscopic-and-molecular-docking-techniques-to-study-the-antibacterial-mechanism-of-thymol-against-staphylococcus-aureus-membrane-damage-and-genomic-dna-binding
#12
Lang-Hong Wang, Zhi-Hong Zhang, Xin-An Zeng, De-Ming Gong, Man-Sheng Wang
Thymol (2-isopropyl-5-methylphenol) is a natural ingredient used as flavor or preservative agent in food products. The antibacterial mechanism of thymol against Gram-positive, Staphylococcus aureus was investigated in this work. A total of 15 membrane fatty acids were identified in S. aureus cells by gas chromatography-mass spectrometry. Exposure to thymol at low concentrations induced obvious alterations in membrane fatty acid composition, such as decreasing the proportion of branched 12-methyltetradecanoic acid and 14-methylhexadecanoic acid (from 22...
November 29, 2016: Analytical and Bioanalytical Chemistry
https://www.readbyqxmd.com/read/27900286/selective-and-efficient-elimination-of-vibrio-cholerae-with-a-chemical-modulator-that-targets-glucose-metabolism
#13
Young Taek Oh, Hwa Young Kim, Eun Jin Kim, Junhyeok Go, Wontae Hwang, Hyoung Rae Kim, Dong Wook Kim, Sang Sun Yoon
Vibrio cholerae, a Gram-negative bacterium, is the causative agent of pandemic cholera. Previous studies have shown that the survival of the seventh pandemic El Tor biotype V. cholerae strain N16961 requires production of acetoin in a glucose-rich environment. The production of acetoin, a neutral fermentation end-product, allows V. cholerae to metabolize glucose without a pH drop, which is mediated by the production of organic acid. This finding suggests that inhibition of acetoin fermentation can result in V...
2016: Frontiers in Cellular and Infection Microbiology
https://www.readbyqxmd.com/read/27899918/mechanistic-basis-of-antimicrobial-actions-of-silver-nanoparticles
#14
REVIEW
Tikam Chand Dakal, Anu Kumar, Rita S Majumdar, Vinod Yadav
Multidrug resistance of the pathogenic microorganisms to the antimicrobial drugs has become a major impediment toward successful diagnosis and management of infectious diseases. Recent advancements in nanotechnology-based medicines have opened new horizons for combating multidrug resistance in microorganisms. In particular, the use of silver nanoparticles (AgNPs) as a potent antibacterial agent has received much attention. The most critical physico-chemical parameters that affect the antimicrobial potential of AgNPs include size, shape, surface charge, concentration and colloidal state...
2016: Frontiers in Microbiology
https://www.readbyqxmd.com/read/27899152/the-anti-staphylococcus-aureus-activity-of-the-phenanthrene-fraction-from-fibrous-roots-of-bletilla-striata
#15
Jing-Jing Guo, Bin-Ling Dai, Ni-Pi Chen, Li-Xia Jin, Fu-Sheng Jiang, Zhi-Shan Ding, Chao-Dong Qian
BACKGROUND: Bletillae Rhizoma, the tuber of Bletilla striata, has been used in Chinese traditional medicine to treat infectious diseases. Chemical studies indicated that phenanthrene was one of the most important components of the herb, with a broad spectrum of antibiotic activity against Gram-positive bacteria. The objective of this study was to further characterize the antibacterial activity of the phenanthrene fraction from the fibrous root of the pseudobulb of B. striata. METHODS: The phenanthrene fraction (EF60) from the ethanol extract of fibrous roots of Bletilla striata pseudobulbs was isolated using polyamide column chromatography...
November 29, 2016: BMC Complementary and Alternative Medicine
https://www.readbyqxmd.com/read/27896581/secondary-metabolites-of-endophytic-xylaria-species-with-potential-applications-in-medicine-and-agriculture
#16
REVIEW
Martha Lydia Macías-Rubalcava, Rosa Elvira Sánchez-Fernández
Fungal endophytes are important sources of bioactive secondary metabolites. The genus Xylaria Hill (ex Schrank, 1789, Xylariaceae) comprises various endophytic species associated to both vascular and non vascular plants. The secondary metabolites produced by Xylaria species include a variety of volatile and non-volatile compounds. Examples of the former are sesquiterpenoids, esters, and alcohols, among others; and of the latter we find terpenoids, cytochalasins, mellein, alkaloids, polyketides, and aromatic compounds...
January 2017: World Journal of Microbiology & Biotechnology
https://www.readbyqxmd.com/read/27891311/comparison-of-antibacterial-efficacy-of-coconut-oil-and-chlorhexidine-on-streptococcus-mutans-an-in-vivo-study
#17
Faizal C Peedikayil, Vimal Remy, Seena John, T P Chandru, Prathima Sreenivasan, Gufran Ahmed Bijapur
AIMS: Streptococcus mutans is the most common organism causing dental caries. Various chemotherapeutic agents are available that help in treating the bacteria, with each having their own merits and demerits. Recent research has shown that coconut oil has anti-inflammatory and antimicrobial action. Therefore, the present was conducted to determine the antibacterial efficacy of coconut oil and to compare it with chlorhexidine. MATERIALS AND METHODS: A total of fifty female children aged 8-12 years were included in the study...
September 2016: Journal of International Society of Preventive & Community Dentistry
https://www.readbyqxmd.com/read/27889340/purification-and-characterization-of-an-antibacterial-and-anti-inflammatory-polypeptide-from-arca-subcrenata
#18
Yuyan Chen, Chunlei Li, Jianhua Zhu, Wangshi Xie, Xianjing Hu, Liyan Song, Jiachen Zi, Rongmin Yu
A polypeptide coded as PGC was isolated from Arca subcrenata muscle using ion exchange, Sephadex G-50 gel chromatography and RP-HPLC. PGC was identified to be a homogeneous compound by Native-PAGE and the purity was more than 98.9% measured by HPLC. The isoelectric point of PGC was determined to be 9.76 by IEF-PAGE. The molecular weight was determined to be 15973.0Da by ESI-MS/MS. The conformational structure of PGC was characterized by UV-vis, FT-IR and CD spectroscopy. N terminal amino acid sequence of PGC was shown as PSVYDAAAQLTADVKKDLRDSWKVIGGDKKGNGVA by Edman degradation...
November 23, 2016: International Journal of Biological Macromolecules
https://www.readbyqxmd.com/read/27889303/pgla-h-tandem-repeat-peptides-active-against-multidrug-resistant-clinical-bacterial-isolates
#19
Tomislav Rončević, Goran Gajski, Nada Ilić, Ivana Goić-Barišić, Marija Tonkić, Larisa Zoranić, Juraj Simunić, Monica Benincasa, Marijana Mijaković, Alessandro Tossi, Davor Juretić
Antimicrobial peptides (AMPs) are promising candidates for new antibiotic classes but often display an unacceptably high toxicity towards human cells. A naturally produced C-terminal fragment of PGLa, named PGLa-H, has been reported to have a very low haemolytic activity while maintaining a moderate antibacterial activity. A sequential tandem repeat of this fragment, diPGLa-H, was designed, as well as an analogue with a Val to Gly substitution at a key position. These peptides showed markedly improved in vitro bacteriostatic and bactericidal activity against both reference strains and multidrug resistant clinical isolates of Gram-negative and Gram-positive pathogens, with generally low toxicity for human cells as assessed by haemolysis, cell viability, and DNA damage assays...
November 23, 2016: Biochimica et Biophysica Acta
https://www.readbyqxmd.com/read/27889013/methicillin-resistant-staphylococcus-aureus-infections-a-review-of-the-currently-available-treatment-options
#20
REVIEW
S M Purrello, J Garau, E Giamarellos, T Mazzei, F Pea, A Soriano, S Stefani
This review is the result of discussions that took place at the 5th MRSA Working Group Consensus Meeting and explores the possible treatment options available for different types of infections due to methicillin-resistant Staphylococcus aureus (MRSA), focusing on those antibiotics that could represent a valid alternative to vancomycin. In fact, whilst vancomycin remains a viable option, its therapy is moving towards individualised dosing. Other drugs, such as the new lipoglycopeptides (oritavancin, dalbavancin and telavancin) and fifth-generation cephalosporins (ceftaroline and ceftobiprole), are showing good in vitro potency and in vivo efficacy, especially for patients infected with micro-organisms with higher vancomycin minimum inhibitory concentrations (MICs)...
December 2016: Journal of Global Antimicrobial Resistance
keyword
keyword
54969
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"