keyword
MENU ▼
Read by QxMD icon Read
search

cockroach

keyword
https://www.readbyqxmd.com/read/28548451/molecular-and-functional-characterization-of-the-american-cockroach-periplaneta-americana-rab5-the-first-exopterygotan-low-molecular-weight-ovarian-gtpase-during-oogenesis
#1
Mohamed Elmogy, Amr A Mohamed, Muhammad Tufail, Tomohide Uno, Makio Takeda
The small Rab GTPases are key regulators of membrane vesicle trafficking. Ovaries of Periplaneta americana (Linnaeus) (Blattodea: Blattidae) have small molecular weight GTP/ATP-binding proteins during early and late vitellogenic periods of oogenesis. However, the identification and characterization of the detected proteins have not been yet reported. Herein, we cloned a cDNA encoding Rab5 from the American cockroach, P. americana, ovaries (PamRab5). It comprises 796 bp, encoding a protein of 213 amino acid residues with a predicted molecular weight of 23...
May 26, 2017: Insect Science
https://www.readbyqxmd.com/read/28545131/major-changes-in-microbial-diversity-and-community-composition-across-gut-sections-of-a-juvenile-panchlora-cockroach
#2
Erin A Gontang, Frank O Aylward, Camila Carlos, Tijana Glavina Del Rio, Mansi Chovatia, Alison Fern, Chien-Chi Lo, Stephanie A Malfatti, Susannah G Tringe, Cameron R Currie, Roberto Kolter
Investigations of gut microbiomes have shed light on the diversity and genetic content of these communities, and helped shape our understanding of how host-associated microorganisms influence host physiology, behavior, and health. Despite the importance of gut microbes to metazoans, our understanding of the changes in diversity and composition across the alimentary tract, and the source of the resident community are limited. Here, using community metagenomics and 16S rRNA gene sequencing, we assess microbial community diversity and coding potential in the foregut, midgut, and hindgut of a juvenile Panchlora cockroach, which resides in the refuse piles of the leaf-cutter ant species Atta colombica...
2017: PloS One
https://www.readbyqxmd.com/read/28541548/unidirectional-cross-resistance-in-german-cockroach-blattodea-blattellidae-populations-under-exposure-to-insecticidal-baits
#3
Dangsheng Liang, Jade McGill, Jose E Pietri
Insect pests, including the German cockroach, Blattella germanica (L.), are prone to the development of physiological resistance when exposed to a number of insecticide sprays, and cross-resistance is frequently observed. Toxic baits are often used as a primary method of controlling German cockroaches, also resulting in heavy selection pressure from insecticidal baits. In response to this pressure, cockroach populations have developed aversion to specific inert ingredients in bait. Here, we examined the effect of exposure to baits containing fipronil, indoxacarb, or hydramethylnon on the development of physiological resistance to the same and other insecticides in a number of German cockroach strains...
May 24, 2017: Journal of Economic Entomology
https://www.readbyqxmd.com/read/28539621/wing-reduction-influences-male-mating-success-but-not-female-fitness-in-cockroaches
#4
Michael Kotyk, Zuzana Varadínová
Although cockroaches (Blattodea s. str.) exhibit high proportion of species with reduced wings, the underlying evolutionary forces remain unclear. Wing reduction in insects is generally considered advantageous for females and a trade-off between investment into the flying apparatus and reproduction is predicted to explain its evolution. However, what if the wing maintenance is an important issue for males' fitness? Males raise wings during the ritualized courtship which is viewed as an unavoidable movement unveiling the tergal glands for female access...
May 24, 2017: Scientific Reports
https://www.readbyqxmd.com/read/28538875/particular-characteristics-of-atopic-eczema-in-tropical-environments-the-tropical-environment-control-for-chronic-eczema-and-molecular-assessment-teccema-cohort-study
#5
Jorge Sánchez, Andrés Sánchez, Ricardo Cardona
Background: Atopic dermatitis is a prevalent health problem in the world. Allergic sensitization is an important risk factor, but the roles of other factors, inherent in tropic region, are unknown. Objective: A cohort study was designed in a tropical city to investigate molecular and environmental risk factors for eczema, considering as particular features perennial exposure to mites, poor living conditions and others tropical characteristics. Methods: 433 patients were included at baseline and biological samples were collected during 24 months of follow-up...
March 2017: Anais Brasileiros de Dermatologia
https://www.readbyqxmd.com/read/28529476/two-parallel-olfactory-pathways-for-processing-general-odors-in-a-cockroach
#6
Hidehiro Watanabe, Hiroshi Nishino, Makoto Mizunami, Fumio Yokohari
In animals, sensory processing via parallel pathways, including the olfactory system, is a common design. However, the mechanisms that parallel pathways use to encode highly complex and dynamic odor signals remain unclear. In the current study, we examined the anatomical and physiological features of parallel olfactory pathways in an evolutionally basal insect, the cockroach Periplaneta americana. In this insect, the entire system for processing general odors, from olfactory sensory neurons to higher brain centers, is anatomically segregated into two parallel pathways...
2017: Frontiers in Neural Circuits
https://www.readbyqxmd.com/read/28528788/cockroach-allergy-and-urban-asthma
#7
EDITORIAL
Peyton A Eggleston
No abstract text is available yet for this article.
May 18, 2017: Journal of Allergy and Clinical Immunology
https://www.readbyqxmd.com/read/28507055/adhesion-and-friction-of-the-smooth-attachment-system-of-the-cockroach-gromphadorhina-portentosa-and-the-influence-of-the-application-of-fluid-adhesives
#8
Oliver Betz, Melina Frenzel, Michael Steiner, Martin Vogt, Malte Kleemeier, Andreas Hartwig, Benjamin Sampalla, Frank Rupp, Moritz Boley, Christian Schmitt
Two different measurement techniques were applied to study the attachment of the smooth foot pads of the Madagascar hissing cockroach Gromphadorhina portentosa The attachment of the non-manipulated adhesive organs was compared with that of manipulated ones (depletion or substitution by artificial secretions). From measurements of the friction on a centrifuge, it can be concluded that on nanorough surfaces, the insect appears to benefit from employing emulsions instead of pure oils to avoid excessive friction...
May 15, 2017: Biology Open
https://www.readbyqxmd.com/read/28506564/contamination-of-cockroaches-insecta-blattaria-to-medically-fungi-a-systematic-review-and-meta-analysis
#9
REVIEW
H Nasirian
INTRODUCTION: Fungal infections have emerged worldwide. Cockroaches have been proved vectors of medically fungi. METHODS: A systematic meta-analysis review about cockroach fungal contamination was investigated. Relevant topics were collected between January 2016 and January 2017. After a preliminary review among 392 collected papers, 156 were selected to become part of the detailed systematic meta-analysis review. RESULTS: Cockroaches contaminated to 38 fungi species belonging to 19 families and 12 orders...
May 11, 2017: Journal de Mycologie Médicale
https://www.readbyqxmd.com/read/28502987/early-social-isolation-impairs-development-mate-choice-and-grouping-behaviour-of-predatory-mites
#10
Peter Schausberger, Marian Gratzer, Markus A Strodl
The social environment early in life is a key determinant of developmental, physiological and behavioural trajectories across vertebrate and invertebrate animals. One crucial variable is the presence/absence of conspecifics. For animals usually reared in groups, social isolation after birth or hatching can be a highly stressful circumstance, with potentially long-lasting consequences. Here, we assessed the effects of social deprivation (isolation) early in life, that is, absence of conspecifics, versus social enrichment, that is, presence of conspecifics, on developmental time, body size at maturity, mating behaviour and group-living in the plant-inhabiting predatory mite Phytoseiulus persimilis...
May 2017: Animal Behaviour
https://www.readbyqxmd.com/read/28497266/an-insecticidal-toxin-from-nephila-clavata-spider-venom
#11
Lin Jin, Mingqian Fang, Mengrou Chen, Chunling Zhou, Rose Ombati, Md Abdul Hakim, Guoxiang Mo, Ren Lai, Xiuwen Yan, Yumin Wang, Shilong Yang
Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis...
May 11, 2017: Amino Acids
https://www.readbyqxmd.com/read/28489864/personality-in-the-cockroach-diploptera-punctata-evidence-for-stability-across-developmental-stages-despite-age-effects-on-boldness
#12
Christina R Stanley, Claudia Mettke-Hofmann, Richard F Preziosi
Despite a recent surge in the popularity of animal personality studies and their wide-ranging associations with various aspects of behavioural ecology, our understanding of the development of personality over ontogeny remains poorly understood. Stability over time is a central tenet of personality; ecological pressures experienced by an individual at different life stages may, however, vary considerably, which may have a significant effect on behavioural traits. Invertebrates often go through numerous discrete developmental stages and therefore provide a useful model for such research...
2017: PloS One
https://www.readbyqxmd.com/read/28486518/complete-mitochondrial-genomes-of-two-blattid-cockroaches-periplaneta-australasiae-and-neostylopyga-rhombifolia-and-phylogenetic-relationships-within-the-blattaria
#13
Jinnan Ma, Chao Du, Chuang Zhou, Yongmei Sheng, Zhenxin Fan, Bisong Yue, Xiuyue Zhang
Complete mitochondrial genomes (mitogenomes) of two cockroach species, Periplaneta australasiae and Neostylopyga rhombifolia, 15,605 bp and 15,711 bp in length, respectively, were determined. As reported for other cockroach mitogenomes, the two mitogenomes possessed typical ancestral insect mitogenome gene composition and arrangement. Only several small intergenic spacers were found: one, which was common in all sequenced cockroach mitogenomes except for the genus Cryptocercus, was between tRNA-Ser (UCN) and ND1 and contained a 7bp highly conserved motif (WACTTAA)...
2017: PloS One
https://www.readbyqxmd.com/read/28480618/beyond-chemoreception-diverse-tasks-of-soluble-olfactory-proteins-in-insects
#14
Paolo Pelosi, Immacolata Iovinella, Jiao Zhu, Guirong Wang, Francesca R Dani
Odorant-binding proteins (OBPs) and chemosensory proteins (CSPs) are regarded as carriers of pheromones and odorants in insect chemoreception. These proteins are typically located in antennae, mouth organs and other chemosensory structures; however, members of both classes of proteins have been detected recently in other parts of the body and various functions have been proposed. The best studied of these non-sensory tasks is performed in pheromone glands, where OBPs and CSPs solubilise hydrophobic semiochemicals and assist their controlled release into the environment...
May 7, 2017: Biological Reviews of the Cambridge Philosophical Society
https://www.readbyqxmd.com/read/28475683/distribution-of-karyotypes-of-the-cryptocercus-punctulatus-species-complex-blattodea-cryptocercidae-in-great-smoky-mountains-national-park
#15
Christine A Nalepa, Keisuke Shimada, Kiyoto Maekawa, Peter Luykx
During the period between 1999 and 2006, wood-feeding cockroaches in the Cryptocercus punctulatus Scudder species complex were collected throughout Great Smoky Mountains National Park, USA. The chromosome numbers of insects from 59 sites were determined, and phylogenetic analyses were performed based on mitochondrial COII and nuclear ITS2 DNA. The distribution of the three male karyotypes found in the park (2n = 37, 39, and 45) is mapped and discussed in relation to recent disturbances and glacial history...
March 1, 2017: Journal of Insect Science
https://www.readbyqxmd.com/read/28475112/insect-active-toxins-with-promiscuous-pharmacology-from-the-african-theraphosid-spider-monocentropus-balfouri
#16
Jennifer J Smith, Volker Herzig, Maria P Ikonomopoulou, Sławomir Dziemborowicz, Frank Bosmans, Graham M Nicholson, Glenn F King
Many chemical insecticides are becoming less efficacious due to rising resistance in pest species, which has created much interest in the development of new, eco-friendly bioinsecticides. Since insects are the primary prey of most spiders, their venoms are a rich source of insect-active peptides that can be used as leads for new bioinsecticides or as tools to study molecular receptors that are insecticidal targets. In the present study, we isolated two insecticidal peptides, µ/ω-TRTX-Mb1a and -Mb1b, from venom of the African tarantula Monocentropus balfouri...
May 5, 2017: Toxins
https://www.readbyqxmd.com/read/28474843/n-glycan-in-cockroach-allergen-regulates-human-basophil-function
#17
Danh C Do, Shuang Yang, Xu Yao, Robert G Hamilton, John T Schroeder, Peisong Gao
INTRODUCTION: Cockroach allergen exposure elicits cockroach sensitization and poses an increased risk for asthma. However, the major components in cockroach allergen and the mechanisms underlying the induction of cockroach allergen-induced allergy and asthma remain largely elusive. We sought to examine the role of cockroach-associated glycan in regulating human basophil function. METHODS: N-linked glycans from naturally purified cockroach allergen Bla g 2 were characterized by MALDI-TOF mass spectrometry...
February 20, 2017: Immunity, Inflammation and Disease
https://www.readbyqxmd.com/read/28456804/climate-and-allergic-sensitization-to-airborne-allergens-in-the-general-population-data-from-the-french-six-cities-study
#18
Denis Charpin, Myriam Ramadour, François Lavaud, Chantal Raherison, Denis Caillaud, Frederic de Blay, Gabrielle Pauli, Isabella Annesi-Maesano
BACKGROUND: The results of international epidemiological surveys show large geographical variations in skin test reactivity but do not provide a rationale for such variations. OBJECTIVE: To assess the relationship between climate and allergic sensitization in schoolchildren. METHODS: In the present study, we analyzed data from a multicenter, epidemiological survey that included 6,461 schoolchildren, aged 9-11 years, living in 6 French cities scattered around France...
April 29, 2017: International Archives of Allergy and Immunology
https://www.readbyqxmd.com/read/28454014/reduced-mouse-allergen-is-associated-with-epigenetic-changes-in-regulatory-genes-but-not-mouse-sensitization-in-asthmatic-children
#19
Rachel L Miller, Hanjie Zhang, Jacqueline Jezioro, Mariangels De Planell Saguer, Stephanie Lovinsky-Desir, Xinhua Liu, Matthew Perzanowski, Adnan Divjan, Wanda Phipatanakul, Elizabeth C Matsui
Chronic exposure to mouse allergen may contribute greatly to the inner-city asthma burden. We hypothesized that reducing mouse allergen exposure may modulate the immunopathology underlying symptomatic pediatric allergic asthma, and that this occurs through epigenetic regulation. To test this hypothesis, we studied a cohort of mouse sensitized, persistent asthmatic inner-city children undergoing mouse allergen-targeted integrated pest management (IPM) vs education in a randomized controlled intervention trial...
April 25, 2017: Environmental Research
https://www.readbyqxmd.com/read/28443674/perinatal-bacterial-exposure-contributes-to-il-13-aeroallergen-response
#20
Benjamin A Turturice, Ravi Ranjan, Brian Nguyen, Lauren M Hughes, Kalista E Andropolis, Diane R Gold, Augusto A Litonjua, Emily Oken, David L Perkins, Patricia W Finn
There is a high prevalence of aeroallergen sensitivity in asthmatic populations, and seroreactivity to aeroallergens early in infancy is associated with increased risk of developing asthma later in life. In addition to allergen sensitivity, asthma development has been associated with differential microbial exposure and infection in early life. We have has previously shown that cord blood mononuclear cells respond to common aeroallergens (i.e., house dust mite (Der f1), cockroach (Bla g2)) as assayed by lymphoproliferation and cytokine (IL-13, IFN-γ) production...
April 26, 2017: American Journal of Respiratory Cell and Molecular Biology
keyword
keyword
53303
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"