Read by QxMD icon Read

bacteria membrane

Zhongbo Zhou, Yiting Tan, Yeyuan Roger Xiao, David C Stuckey
The distribution, composition and morphological structure of sub-visible particles and colloids (0.01-10 µm) in the supernatant of a lab-scale submerged anaerobic membrane reactor (SAnMBR), and their role in membrane fouling, was investigated. Photometric analysis showed that the supernatant and membrane foulants were dominated by particles and colloids (0.45-10 µm), which accounted for over 90% of the total organics (proteins and polysaccharides). Excitation-emission matrix (EEM) fluorescence spectra and monosaccharide analysis showed that these particles and colloids were rich in fluorescent proteins, rhamnose, ribose and arabinose, all of which could be related to cellular and extracellular substances...
October 26, 2016: Environmental Science & Technology
Isabel Clemente, Margarita Aznar, Jesús Salafranca, Cristina Nerín
One critical challenge when developing a new antimicrobial packaging material is to demonstrate the mode of action of the antimicrobials incorporated into the packaging. For this task, several analytical techniques as well as microbiology are required. In this work, the antimicrobial properties of benzyl isothiocyanate, allyl isothiocyanate and essential oils of cinnamon and oregano against several moulds and bacteria have been evaluated. Benzyl isothiocyanate showed the highest antimicrobial activity and it was selected for developing the new active packaging material...
October 25, 2016: Analytical and Bioanalytical Chemistry
Franziska A Mandl, Volker C Kirsch, Ilke Ugur, Elena Kunold, Jan Vomacka, Christian Fetzer, Sabine Schneider, Klaus Richter, Thilo M Fuchs, Iris Antes, Stephan A Sieber
Gram-negative bacteria represent a challenging task for antibacterial drug discovery owing to their impermeable cell membrane and restricted uptake of small molecules. We herein describe the synthesis of natural-product-derived epoxycyclohexenones and explore their antibiotic activity against several pathogenic bacteria. A compound with activity against Salmonella Typhimurium was identified, and the target enzymes were unraveled by quantitative chemical proteomics. Importantly, two protein hits were linked to bacterial stress response, and corresponding assays revealed an elevated susceptibility to reactive oxygen species upon compound treatment...
October 26, 2016: Angewandte Chemie
KathyJo Ann Jackson
Klebsiella oxytoca is a gram-negative bacterium that can be found throughout the environment as well as on mucosal membranes of mammals including humans. This bacterium is responsible for a variety of infections in humans including nosocomial infections resulting in hospital outbreaks. Reptiles including snakes, tuataras, and turtles have been shown to harbor this bacterium, and previous studies have shown that pet reptiles are a potential source for dissemination of pathogenic bacteria. Green anoles (Anolis carolensis) are a common lizard found in the southeastern part of the United States...
October 25, 2016: Vector Borne and Zoonotic Diseases
Nandini Venkateswaran, Rachel A F Wozniak, Holly B Hindman
Purpose. To describe a unique case of O. anthropi keratitis associated with a rare manifestation of Descemet's membrane detachment and intracorneal hypopyon and to discuss challenges in diagnosis and management. Methods. Best-corrected visual acuity was measured with Snellen letters. Corneal scrapings were performed and aerobic, viral, herpetic, acid-fast bacilli, Acanthamoeba, and fungal stains and cultures were obtained. Following evisceration, tissue was evaluated for histologic features and again stained for bacteria, mycobacteria, Acanthamoeba, fungi, and viral particles...
2016: Case Reports in Ophthalmological Medicine
Vera Pader, Sanika Hakim, Kimberley L Painter, Sivaramesh Wigneshweraraj, Thomas B Clarke, Andrew M Edwards
Daptomycin is a bactericidal antibiotic of last resort for serious infections caused by methicillin-resistant Staphylococcus aureus (MRSA)(1,2). Although resistance is rare, treatment failure can occur in more than 20% of cases(3,4) and so there is a pressing need to identify and mitigate factors that contribute to poor therapeutic outcomes. Here, we show that loss of the Agr quorum-sensing system, which frequently occurs in clinical isolates, enhances S. aureus survival during daptomycin treatment. Wild-type S...
October 24, 2016: Nature Microbiology
Nadine Czekalski, Stefanie Imminger, Elisabeth Salhi, Marjan Veljkovic, Karolin Kleffel, David Drissner, Frederik Hammes, Helmut Bürgmann, Urs von Gunten
Ozone, a strong oxidant and disinfectant, seems ideal to cope with future challenges of water treatment, such as micropollutants, multiresistant bacteria (MRB) and even intracellular antibiotic resistance genes (ARG), but information on the latter is scarce. In ozonation experiments we simultaneously determined kinetics and dose-dependent inactivation of Escherichia coli and its plasmid-encoded sulfonamide resistance gene sul1 in different water matrixes. Effects in E. coli were compared to an autochthonous wastewater community...
October 24, 2016: Environmental Science & Technology
Jing Lu, Zhenning Wang, Mengrou Ren, Guoren Huang, Baochen Fang, Xiujuan Bu, Yanhui Liu, Shuang Guan
In the study, we investigated the antibacterial activity and mechanism of gallic acid against Aeromonas hydrophila and Aeromonas sobria. Gallic acid showed strong antimicrobial activity against the two bacteria. Furthermore, the antibacterial mechanism of gallic acid (0, 3, 6, 12 mM ) was performed by membrane integrity assay and scanning electron microscopy (SEM) assay. The results showed that gallic acid notably increased the released material absorption value at 260, 280 nm and electric conductivity in a dose-dependent manner...
October 22, 2016: Current Pharmaceutical Biotechnology
François Vromman, Stéphanie Perrinet, Lena Gehre, Agathe Subtil
Chlamydiae are Gram negative bacteria that develop exclusively inside eukaryotic host cells, within a membrane-bounded compartment. Members of the family Chlamydiaceae, such as Chlamydia trachomatis, are pathogenic species infecting vertebrates. They have a very reduced genome and exploit the capacities of their host for their own development, mainly through the secretion of proteins tailored to interfere with eukaryotic processes, called effector proteins. All Chlamydiaceae possess genes coding for four to five effectors that share a domain of unknown function (DUF582)...
2016: Frontiers in Cellular and Infection Microbiology
Shin-Ichi Yokobori, Yoshiki Nakajima, Satoshi Akanuma, Akihiko Yamagishi
Bacteria and Eukarya have cell membranes with sn-glycerol-3-phosphate (G3P), whereas archaeal membranes contain sn-glycerol-1-phosphate (G1P). Determining the time at which cells with either G3P-lipid membranes or G1P-lipid membranes appeared is important for understanding the early evolution of terrestrial life. To clarify this issue, we reconstructed molecular phylogenetic trees of G1PDH (G1P dehydrogenase; EgsA/AraM) which is responsible for G1P synthesis and G3PDHs (G3P dehydrogenase; GpsA and GlpA/GlpD) and glycerol kinase (GlpK) which is responsible for G3P synthesis...
2016: Archaea: An International Microbiological Journal
Lingling Zhang, Huan Qi, Zhengxu Yan, Yu Gu, Weiqiang Sun, Abraham Amenay Zewde
The present study evaluated inactivation efficiency of a sonophotocatalytic process using ZnO nanofluids including ultrasonic parameters such as power density, frequency and time. The result showed that inactivation efficiency was increased by 20% when ultrasonic irradiation was combined with photocatalytic process in the presence of natural light. Comparison of inactivation efficiency in photocatalytic, ultrasonic and sonocatalytic processes using Escherichia coli as a model bacteria identified that inactivation efficiencies are shown in the following order: ultrasonic irradiation<sonocatalysis<photocatalysis<sonophotocatalysis...
January 2017: Ultrasonics Sonochemistry
Masahiro Ito, Yuka Takahashi
Prior to 2008, all previously studied conventional bacterial flagellar motors appeared to utilize either H(+) or Na(+) as coupling ions. Membrane-embedded stator complexes support conversion of energy using transmembrane electrochemical ion gradients. The main H(+)-coupled stators, known as MotAB, differ from Na(+)-coupled stators, PomAB of marine bacteria, and MotPS of alkaliphilic Bacillus. However, in 2008, a MotAB-type flagellar motor of alkaliphilic Bacillus clausii KSM-K16 was revealed as an exception with the first dual-function motor...
October 22, 2016: Extremophiles: Life Under Extreme Conditions
Johnson Lin
Quantification of gene expression of Acinetobacter strain Y under 1000 mg/l of phenol was investigated using qPCR and proteomic analyses. The results show that Acinetobacter strain Y utilized 100 % of phenol within 18 h of exposure. The results of qPCR and proteomic analyses demonstrate a sequential expression of phenol-degrading genes of Acinetobacter strain Y via the ortho-pathway followed by the β-ketoadipate pathway. Many stress-responsive proteins such as chaperones, chaperonins, porins and the enzymes involved in the signal transduction pathway were upregulated especially in the early stage...
October 22, 2016: Archives of Microbiology
Xiaxia Meng, Dengwu Li, Dan Zhou, Dongmei Wang, Qiaoxiao Liu, Sufang Fan
ETHNOPHARMACOLOGICAL RELEVANCE: Juniperus rigida is used as Tibetan and Mongolian medicine in China for the treatment of rheumatoid arthritis, nephritis, brucellosis and other various inflammatory diseases. AIM OF THE STUDY: To evaluate antibacterial potential of essential oils from J. rigida leaves against Klebsiella pneumoniae and to examine its possible related mechanisms. The study was undertaken in order to scientifically validate the traditional use of J. rigida...
October 18, 2016: Journal of Ethnopharmacology
Florian Graef, Branko Vukosavljevic, Jean-Philippe Michel, Marius Wirth, Oliver Ries, Chiara De Rossi, Maike Windbergs, Véronique Rosilio, Christian Ducho, Sarah Gordon, Claus-Michael Lehr
Gram-negative bacteria possess a unique and complex cell envelope, composed of an inner and outer membrane separated by an intermediate cell wall-containing periplasm. This tripartite structure acts intrinsically as a significant biological barrier, often limiting the permeation of anti-infectives, and so preventing such drugs from reaching their target. Furthermore, identification of the specific permeation-limiting envelope component proves difficult in the case of many anti-infectives, due to the challenges associated with isolation of individual cell envelope structures in bacterial culture...
October 18, 2016: Journal of Controlled Release: Official Journal of the Controlled Release Society
Pradipta Ranjan Rauta, Sarbani Ashe, Debasis Nayak, Bismita Nayak
Virulence-related outer membrane proteins (Omps) are expressed in bacteria (Gram-negative) such as V. cholerae and are vital to bacterial invasion in to eukaryotic cell and survival within macrophages that could be best candidate for development of vaccine against V. cholerae. Applying in silico approaches, the 3-D model of the Omp was developed using Swiss model server and validated byProSA and Procheck web server. The continuous stretch of amino acid sequences 26mer: RTRSNSGLLTWGDKQTITLEYGDPAL and 31mer: FFAGGDNNLRGYGYKSISPQDASGALTGAKY having B-cell binding sites were selected from sequence alignment after B cell epitopes prediction by BCPred and AAP prediction modules of BCPreds...
October 12, 2016: Computational Biology and Chemistry
Narges Abdali, Jerry Matthew Parks, Keith Haynes, Julie L Chaney, Adam T Green, David Wolloscheck, John K Walker, Valentin V Rybenkov, Jerome Yves Baudry, Jeremy C Smith, Helen I Zgurskaya
Antibiotic resistance is a major threat to human welfare. Inhibitors of multidrug efflux pumps (EPIs) are promising alternative therapeutics that could revive activities of antibiotics and reduce bacterial virulence. Identification of new druggable sites for inhibition is critical for development of effective EPIs, especially in light of constantly emerging resistance. Here, we describe EPIs that interact with periplasmic membrane fusion proteins, critical components of efflux pumps that are responsible for the activation of the transporter and the recruitment of the outer-membrane channel...
October 21, 2016: ACS Infectious Diseases
Daniela Albanesi, Diego de Mendoza
Phospholipids and fatty acids are not only one of the major components of cell membranes but also important metabolic intermediates in bacteria. Since the fatty acid biosynthetic pathway is essential and energetically expensive, organisms have developed a diversity of homeostatic mechanisms to fine-tune the concentration of lipids at particular levels. FapR is the first global regulator of lipid synthesis discovered in bacteria and is largely conserved in Gram-positive organisms including important human pathogens, such as Staphylococcus aureus, Bacillus anthracis, and Listeria monocytogenes...
2016: Frontiers in Molecular Biosciences
Katherine C Faulkner, Katherine A Hurley, Douglas B Weibel
Antibiotic adjuvant therapy represents an exciting opportunity to enhance the activity of clinical antibiotics by co-dosing with a secondary small molecule. Successful adjuvants decrease the concentration of antibiotics used to defeat bacteria, increase activity (in some cases introducing activity against organisms that are drug resistant), and reduce the frequency at which drug-resistant bacteria emerge. We report that 5-alkyloxytryptamines are a new class of broad-spectrum antibacterial agents with exciting activity as antibiotic adjuvants...
October 5, 2016: Bioorganic & Medicinal Chemistry Letters
Brendan W Corey, Mitchell G Thompson, Lauren E Hittle, Anna C Jacobs, Edward A Asafo-Adjei, William Huggins, Roberta J Melander, Christian Melander, Robert K Ernst, Daniel V Zurawski
Acinetobacter baumannii are gram-negative bacilli that pose a constant threat to susceptible patients because of increased resistance to multiple antibiotics and persistence in the hospital environment. After genome analysis, we discovered that A. baumannii harbor genes that share homology to an enzymatic pathway that elongates long chain fatty acids (LCFA) in fungi. Previously, 1,2,4-Triazolidine-3-thiones (T-3-Ts) were shown to inhibit hyphae production in fungi, and this same LCFA elongation pathway was implicated as the possible target...
October 20, 2016: ACS Infectious Diseases
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"