Read by QxMD icon Read


R Boni, A Gallo, S Cecchini
Owing to the progressive decline of sperm motility during storage there is a need to find substances capable of enhancing sperm energy metabolism and motility and/or preserving it from oxidative damage. The aim of this study was to evaluate in frozen/thawed bovine spermatozoa the effect of several compounds, such as myo-inositol, pentoxifylline, penicillamine + hypotaurine + epinephrine mixture (PHE), caffeine and coenzyme Q10+ zinc + d-aspartate mixture (CZA), on either kinetic or metabolic parameters. Sperm kinetics was evaluated by Sperm Class Analyser whereas specific fluorochromes were used to evaluated mitochondrial membrane potential (MMP), intracellular pH, intracellular calcium concentration and lipid peroxidation...
October 21, 2016: Andrology
Miao Liu, Ling Zhou, Baiyu Zhang, Minhong He, Xiaoying Dong, Xiaojun Lin, Chunhong Jia, Xiaochun Bai, Yifan Dai, Yongchun Su, Zhipeng Zou, Hang Zheng
Although epidemiological and preclinical studies have shown the preventative effect of n-3 polyunsaturated fatty acids (PUFAs) on colorectal cancer (CRC), the underlying molecular mechanisms are not clear. In this study, we revealed that elevation of n-3/n-6 PUFAs ratio suppress the mechanistic target of rapamycin complex 1 (mTORC1) and prevent colorectal tumorigenesis. The transgenic expression of fat-1, a desaturase that catalyzes the conversion of n-6 to n-3 PUFAs and produces n-3 PUFAs endogenously, repressed colorectal tumor cell growth and remarkably reduced tumor burden, and alleviated anemia as well as hyperlipidemia in APCMin/+ (adenomatous polyposis coli) mice, a classic CRC model that best simulates most clinical cases...
October 19, 2016: Oncotarget
Ryota Saito, Maiko Hoshi, Akihiro Kato, Chikako Ishikawa, Toshiya Komatsu
A number of (Z)-4-arylmethylene-1H-imidazol-5(4H)-ones, which are related to the fluorescent chromophore of the Aequorea green fluorescent protein (GFP), have been synthesized and evaluated their in vitro inhibitory activity against recombinant human aldose reductase for the first time. The GFP chromophore model 1a, with a p-hydroxy group on the 4-benzylidene and a carboxymethyl group on the N1 position, exhibited strong bioactivity with an IC50 value of 0.36 μM. This efficacy is higher than that of sorbinil, a known highly potent aldose reductase inhibitor...
October 8, 2016: European Journal of Medicinal Chemistry
Eleni Pitta, Olga Balabon, Maciej K Rogacki, Jesús Gómez, Fraser Cunningham, Jurgen Joosens, Koen Augustyns, Pieter van der Veken, Robert Bates
During the construction of bioactive molecules, regioselective alkylation of heterocyclic, N/O ambident nucleophiles is a frequently encountered synthetic transformation. In this framework, specific attention is required to unambiguously determine the structures of obtained reaction products. As part of our project on quinoloxyacetamide based antimycobacterial agents, a series of N- or O- alkylated quinolin-4-ol, 1,5-naphthyridin-4-ol and quinazolin-4-ol derivatives were prepared during the course of which we observed unexpected selectivity issues...
October 11, 2016: European Journal of Medicinal Chemistry
Pradipta Ranjan Rauta, Sarbani Ashe, Debasis Nayak, Bismita Nayak
Virulence-related outer membrane proteins (Omps) are expressed in bacteria (Gram-negative) such as V. cholerae and are vital to bacterial invasion in to eukaryotic cell and survival within macrophages that could be best candidate for development of vaccine against V. cholerae. Applying in silico approaches, the 3-D model of the Omp was developed using Swiss model server and validated byProSA and Procheck web server. The continuous stretch of amino acid sequences 26mer: RTRSNSGLLTWGDKQTITLEYGDPAL and 31mer: FFAGGDNNLRGYGYKSISPQDASGALTGAKY having B-cell binding sites were selected from sequence alignment after B cell epitopes prediction by BCPred and AAP prediction modules of BCPreds...
October 12, 2016: Computational Biology and Chemistry
Jowita Marszewska, Mietek Jaroniec
Highly-porous carbon spheres were prepared by modified Stöber method combined with silica templating and CO2 activation. Silica was delivered in the form of either colloids or tetraethyl orthosilicate and used to create porosity. Subsequently, CO2 activation was used to develop microporosity. CO2 activation was done either: (1) on carbon spheres, following silica etching or (2) on silica-carbon composites, before silica removal. Both methods delivered carbon materials with well-developed structures and, importantly, preserved spherical morphology...
October 15, 2016: Journal of Colloid and Interface Science
Mair Underwood
BACKGROUND: As a result of the mainstreaming of bodybuilding, the majority of image and performance enhancing drug (IPED) users are now not athletes or competitive bodybuilders, but recreational bodybuilders. Previous approaches provide little insight into how the shift from competitive to recreational contexts impacts the use of IPEDs. METHODS: In this study an online ethnographic approach is used to explore the social lives of IPEDs in a recreational context. The study focusses on the Zyzz fandom, an international online community of thousands of recreational bodybuilders who idolise the alleged IPED user Zyzz...
October 18, 2016: International Journal on Drug Policy
Sanna Rönkä, Anu Katainen
BACKGROUND: The non-medical use of prescription drugs is a growing phenomenon associated with increasing health-related harms. However, little is known about the drivers of this process among illicit drug users. Our aim is to show how the qualities of pharmaceutical drugs, pharmaceutical related knowledge, online communities sharing this knowledge and medical professionals mediate and transform the consumption behaviour related to pharmaceutical drugs. METHODS: The data consist of discussion threads from an online drug use forum...
October 18, 2016: International Journal on Drug Policy
Michael P Atkinson, Moshe Kress, Roberto Szechtman
BACKGROUND: The US invests considerable effort in searching and interdicting drug-trafficking vessels in the Caribbean and Eastern Pacific regions. While some vessels are indeed interdicted, resulting in confiscation of substantial quantities of drugs, many such vessels manage to avoid detection and arrive safely at their destinations in Central America and Mexico with their drug load intact. The agency in charge of interdicting this traffic, Joint Interagency Task Force South-JIATF-S, sends out both aerial and surface assets for search and interdiction missions...
October 18, 2016: International Journal on Drug Policy
Alexandra C Sundermann, Troy D Abell, Lisa C Baker, Mark B Mengel, Kathryn E Reilly, Michael A Bonow, Gregory E Hoy, Richard D Clover
BACKGROUND: The specialization of human fat deposits is an inquiry of special importance in the study of fetal growth. It has been theorized that maternal lower-body fat is designated specifically for lactation and not for the growth of the fetus. OBJECTIVE: Our goal was to compare the contributions of maternal upper-body versus lower-body adiposity to infant birth weight. We hypothesized that upper-body adiposity would be strongly associated with infant birth weight and that lower-body adiposity would be weakly or negligibly associated with infant birth weight-after adjusting for known determinants...
September 21, 2016: European Journal of Obstetrics, Gynecology, and Reproductive Biology
Stacy-Anne Morgan, Dana C Nadler, Rayka Yokoo, David F Savage
Metabolic engineering offers the potential to renewably produce important classes of chemicals, particularly biofuels, at an industrial scale. DNA synthesis and editing techniques can generate large pathway libraries, yet identifying the best variants is slow and cumbersome. Traditionally, analytical methods like chromatography and mass spectrometry have been used to evaluate pathway variants, but such techniques cannot be performed with high throughput. Biosensors - genetically encoded components that actuate a cellular output in response to a change in metabolite concentration - are therefore a promising tool for rapid and high-throughput evaluation of candidate pathway variants...
October 18, 2016: Current Opinion in Chemical Biology
Han Qin, Lin Luo, Zexin Zhu, Jiwei Huang
OBJECTIVE: To examine whether pancreaticogastrostomy (PG) or pancreaticojejunostomy (PJ) is the best reconstruction method to reduce occurrence of postoperative complications, especially pancreatic fistula (PF), after pancreaticoduodenectomy (PD). BACKGROUND: PF is one of the most severe complications after PD. The best reconstruction method to reduce occurrence of PF is controversial. Therefore, we carried out this meta-analysis to compare PG with PJ. METHODS: A systematic review was conducted in PubMed, EMBASE, and Cochrane Library to identify studies comparing PG with PJ, published up to October 2015...
October 18, 2016: International Journal of Surgery
Yoshiya Horimoto, Atsushi Arakawa, Noriko Sasahara, Masahiko Tanabe, Sei Sai, Takanori Himuro, Mitsue Saito
The combination of CD44 and CD24, or aldehyde dehydrogenase 1 (ALDH1) alone, is a widely used cancer stem cell marker in breast cancer. However, no conclusion has yet been reached as to which marker is the best for characterizing cancer stemness. Immunohistochemical evaluation using cancer stem cell markers is clearly less common clinically than in basic experiments and how the expressions of these markers relate to patient outcomes remains controversial. To investigate whether combining these markers might improve the prediction of patient outcomes, we immunohistochemically examined clinical samples...
2016: PloS One
Wen Yea Hwong, Michiel L Bots, Sharmini Selvarajah, L Jaap Kappelle, Zariah Abdul Aziz, Norsima Nazifah Sidek, Ilonca Vaartjes
BACKGROUND: A shortage of computed tomographic (CT) machines in low and middle income countries often results in delayed CT imaging for patients suspected of a stroke. Yet, time constraint is one of the most important aspects for patients with an ischemic stroke to benefit from thrombolytic therapy. We set out to assess whether application of the Siriraj Stroke Score is able to assist physicians in prioritizing patients with a high probability of having an ischemic stroke for urgent CT imaging...
2016: PloS One
Nitzan Krinsky, Maya Kaduri, Janna Shainsky-Roitman, Mor Goldfeder, Eran Ivanir, Itai Benhar, Yuval Shoham, Avi Schroeder
Cell-free protein synthesis (CFPS) systems are important laboratory tools that are used for various synthetic biology applications. Here, we present a simple and inexpensive laboratory-scale method for preparing a CFPS system from E. coli. The procedure uses basic lab equipment, a minimal set of reagents, and requires less than one hour to process the bacterial cell mass into a functional S30-T7 extract. BL21(DE3) and MRE600 E. coli strains were used to prepare the S30-T7 extract. The CFPS system was used to produce a set of fluorescent and therapeutic proteins of different molecular weights (up to 66 kDa)...
2016: PloS One
Anita Barikian, Haytham Salti, Ammar Safar, Ziyad R Mahfoud, Ziad F Bashshur
PURPOSE: To study the benefit of intravitreal dexamethasone implant in the management of neovascular age-related macular degeneration resistant to bevacizumab and ranibizumab. METHODS: Patients with persistent macular fluid on optical coherence tomography despite monthly treatment with at least three consecutive bevacizumab injections followed by at least three ranibizumab injections were prospectively enrolled. A single dexamethasone implant was administered followed by intravitreal ranibizumab 1 week later...
October 20, 2016: Retina
Dorimar Stiz, Adriana Campos, Ana Lúcia Tasca Gois Ruiz, João Ernesto de Carvalho, Rogério Corrêa, Valdir Cechinel-Filho
This work describes the antiproliferative potential of 14 cyclic imides (methylphtalimides, carboxylic acid phtalimides and itaconimides) against several human cancer cell lines. The antiproliferative effect was evaluated using the sulforhodamine B assay. Although some compounds from methylphtalimide and carboxylic acid phtalimide classes exhibited a selective antiproliferative activity, the itaconimides (11-14) exhibited the best results, especially compound 14, which presented a TGI (concentration that produces total growth inhibition) value of 0...
October 21, 2016: Zeitschrift Für Naturforschung. C, A Journal of Biosciences
Iuliana L Calugaru, Carmen Mihaela Neculita, Thomas Genty, Bruno Bussière, Robin Potvin
In the present study, wood ash was modified by alkaline fusion, prior to hydrothermal synthesis, for potential application in the treatment of mine drainage impacted water. With this objective, two types of wood ash (both raw and modified) were evaluated for the treatment of Ni and Zn in contaminated neutral drainage (CND). Batch adsorption experiments were initially conducted on synthetic CND, and then on two real CND, sampled on two active mine sites, contaminated by either Ni (3.7 mg/L) or Zn (9.1 mg/L)...
October 21, 2016: Journal of Environmental Science and Health. Part A, Toxic/hazardous Substances & Environmental Engineering
Qingwen Lin, Jiali Chang, Mengfan Gao, Hongzhu Ma
Epichlorohydrin cross-linked carboxymethyl cellulose microspheres (ECH/CMC) obtained by inverse suspension method and magnetic Fe3O4 nanoparticles encasing the ECH/CMC microspheres (M-ECH/CMC) obtained by two different methods were successfully prepared and compared. Their structures and morphologies were analyzed using polarizing microscopy, scanning electron microscopy, Fourier transform infrared spectroscopy, and X-ray diffraction. The adsorption behaviors of M1-ECH/CMC for methylene blue (MB) in the single cationic dye wastewater, the cationic/anionic dye mixture in the absence or presence of co-existed additives (salt and surfactant) wastewater, were also investigated with UV-vis spectrometer...
October 21, 2016: Journal of Environmental Science and Health. Part A, Toxic/hazardous Substances & Environmental Engineering
David Herzig, Moreno Testorelli, Daniela Schäfer Olstad, Daniel Erlacher, Peter Achermann, Prisca Eser, Matthias Wilhelm
BACKGROUND/AIM: There is increasing popularity for athletes to use heart rate variability (HRV) to tailor training. A time-efficient method is HRV assessment during deep sleep. The aim was to validate the selection of deep sleep segments identified by RR-intervals with simultaneous electroencephalography (EEG) recordings and to compare HRV parameters of these segments with those of standard morning supine measurements. METHODS: In 11 world class alpine- skiers, RR-intervals were monitored during ten nights and simultaneous EEGs were recorded in 2-4 nights...
September 26, 2016: International Journal of Sports Physiology and Performance
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"