keyword
MENU ▼
Read by QxMD icon Read
search

NET's

keyword
https://www.readbyqxmd.com/read/29145657/the-utility-of-blood-neuroendocrine-gene-transcript-measurement-in-the-diagnosis-of-bronchopulmonary-neuroendocrine-tumours-and-as-a-tool-to-evaluate-surgical-resection-and-disease-progression
#1
Pier Luigi Filosso, Mark Kidd, Matteo Roffinella, Anna Lewczuk, Kyung-Min Chung, Agnieszka Kolasinska-Cwikla, Jaroslaw Cwikla, Anna Lowczak, Anna Doboszynska, Anna Malczewska, Maria Catalano, Valentina Zunino, Monica Boita, Emanuela Arvat, Riccardo Cristofori, Francesco Guerrera, Alberto Oliaro, Margot Tesselaar, Wieneke Buikhuisen, Beata Kos-Kudla, Mauro Papotti, Lisa Bodei, Ignat Drozdov, Irvin Modlin
OBJECTIVES: The management of bronchopulmonary neuroendocrine tumours (BPNETs) is difficult, since imaging, histology and biomarkers have a limited value in diagnosis, predicting outcome and defining therapeutic efficacy. We evaluated a NET multigene blood test (NETest) to diagnose BPNETs, assess disease status and evaluate surgical resection. METHODS: (i) Diagnostic cohort: BP carcinoids (n = 118)-typical carcinoid, n = 67 and atypical carcinoid, n = 51; other lung NEN (large-cell neuroendocrine carcinoma and small-cell lung carcinoma, n = 13); adenocarcinoma, (n = 26); squamous cell carcinoma (n = 23); controls (n = 90) and chronic obstructive pulmonary disease (n = 18)...
November 13, 2017: European Journal of Cardio-thoracic Surgery
https://www.readbyqxmd.com/read/29145446/large-scale-climatic-effects-on-traditional-hawaiian-fishpond-aquaculture
#2
Daniel McCoy, Margaret A McManus, Keliʻiahonui Kotubetey, Angela Hiʻilei Kawelo, Charles Young, Brandon D'Andrea, Kathleen C Ruttenberg, Rosanna ʻAnolani Alegado
Aquaculture accounts for almost one-half of global fish consumption. Understanding the regional impact of climate fluctuations on aquaculture production thus is critical for the sustainability of this crucial food resource. The objective of this work was to understand the role of climate fluctuations and climate change in subtropical coastal estuarine environments within the context of aquaculture practices in He'eia Fishpond, O'ahu Island, Hawai'i. To the best of our knowledge, this was the first study of climate effects on traditional aquaculture systems in the Hawaiian Islands...
2017: PloS One
https://www.readbyqxmd.com/read/29145267/osteoblastic-bone-metastases-from-neuroendocrine-tumor-net-of-unknown-origin-detected-by-18fluorocholine-pet-ct-and-its-comparison-with-68gallium-dotatoc-pet-ct-case-report-and-review-of-the-literature
#3
Alberto Bongiovanni, Federica Recine, Monica Celli, Giulia Marcantognini, Flavia Foca, Chiara Liverani, Valentina Fausti, Alessandro De Vita, Giacomo Miserocchi, Laura Mercatali, Dino Amadori, Toni Ibrahim
RATIONALE: Choline (CH) positron emission tomography (PET)/computed tomography (CT) with fluorine 18 (F) CH is increasingly used not only to evaluate patients with biochemically recurrent prostate cancer but also to assess metastatic lesions that are difficult or impossible to identify using more conventional modalities. Our experience with CH PET/CT has shown that it can also be used for many other malignancies. PRESENTING CONCERNS: A 71-year-old male with a neuroendocrine tumor (NET) of unknown origin showed osteoblastic bone metastases positive to F-CH PET...
November 2017: Medicine (Baltimore)
https://www.readbyqxmd.com/read/29145140/fluoxetine-modulates-the-transcription-of-genes-involved-in-serotonin-dopamine-and-adrenergic-signalling-in-zebrafish-embryos
#4
V Cunha, P Rodrigues, M M Santos, P Moradas-Ferreira, M Ferreira
Neurotransmitters pathways in fish and mammals are phylogenetically conserved. Therefore, the environmental presence of psychopharmaceuticals, such as fluoxetine (FLU), are likely to interact with fish serotonergic, dopaminergic and adrenergic systems, affecting their response and associated biological functions. Hence, the present work aimed at evaluating the effects of FLU in the transcription of genes involved in serotonin, dopamine and adrenergic transporters and receptors signalling in early stages of Danio rerio development...
October 27, 2017: Chemosphere
https://www.readbyqxmd.com/read/29145084/low-voltage-electric-potential-as-a-driving-force-to-hinder-biofouling-in-self-supporting-carbon-nanotube-membranes
#5
Chidambaram Thamaraiselvan, Avner Ronen, Sofia Lerman, Moran Balaish, Yair Ein-Eli, Carlos G Dosoretz
This study aimed at evaluating the contribution of low voltage electric field, both alternating (AC) and direct (DC) currents, on the prevention of bacterial attachment and cell inactivation to highly electrically conductive self-supporting carbon nanotubes (CNT) membranes at conditions which encourage biofilm formation. A mutant strain of Pseudomonas putida S12 was used a model bacterium and either capacitive or resistive electrical circuits and two flow regimes, flow-through and cross-flow filtration, were studied...
November 3, 2017: Water Research
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#6
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29144866/challenges-in-the-clinical-application-of-the-american-society-of-clinical-oncology-value-framework-a-medicare-cost-benefit-analysis-in-chronic-lymphocytic-leukemia
#7
Erlene K Seymour, Charles A Schiffer, Jonas A de Souza
PURPOSE: The ASCO Value Framework calculates the value of cancer therapies. Given costly novel therapeutics for chronic lymphocytic leukemia, we used the framework to compare net health benefit (NHB) and cost within Medicare of all regimens listed in the National Comprehensive Cancer Network (NCCN) guidelines. METHODS: The current NCCN guidelines for chronic lymphocytic leukemia were reviewed. All referenced studies were screened, and only randomized controlled prospective trials were included...
November 16, 2017: Journal of Oncology Practice
https://www.readbyqxmd.com/read/29144820/pheochromocytoma-a-genetic-and-diagnostic-update
#8
Leilani B Mercado-Asis, Katherine I Wolf, Ivana Jochmanova, David Taïeb
OBJECTIVE: Pheochromocytomas and paragangliomas (PPGLs) are neuroendocrine tumors derived from adrenal or extra-adrenal locations, respectively. Upon suspicion of PPGL, specific metabolomic, molecular, biochemical, imaging, and histopathological studies are performed to prove, localize, treat, and monitor disease progression. Recently, improved diagnostic tools allow physicians to accurately diagnose PPGL, even in patients presenting with small (less than 1 cm) or biochemically silent tumors, which previously delayed proper detection and treatment...
November 16, 2017: Endocrine Practice
https://www.readbyqxmd.com/read/29144535/a-health-economic-outcome-evaluation-of-an-internet-based-mobile-supported-stress-management-intervention-for-employees
#9
David Daniel Ebert, Fanny Kählke, Claudia Buntrock, Matthias Berking, Filip Smit, Elena Heber, Harald Baumeister, Burkhardt Funk, Heleen Riper, Dirk Lehr
Objective This study aimed to estimate and evaluate the cost-effectiveness and cost-benefit of a guided internet- and mobile-supported occupational stress-management intervention (iSMI) for employees from the employer's perspective alongside a randomized controlled trial. Methods A sample of 264 employees with elevated symptoms of perceived stress (Perceived Stress Scale, PSS-10 ≥22) was randomly assigned either to the iSMI or a waitlist control (WLC) group with unrestricted access to treatment as usual. The iSMI consisted of seven sessions of problem-solving and emotion-regulation techniques and one booster session...
November 16, 2017: Scandinavian Journal of Work, Environment & Health
https://www.readbyqxmd.com/read/29144026/heart-rate-variability-and-implication-for-sport-concussion
#10
REVIEW
Scott A Bishop, Ryan T Dech, Przemyslaw Guzik, J Patrick Neary
Finding sensitive and specific markers for sports-related concussion is both challenging and clinically important. Such biomarkers might be helpful in the management of patients with concussion (i.e. diagnosis, monitoring and risk prediction). Among many parameters, blood flow-pressure metrics and heart rate variability (HRV) have been used to gauge concussion outcomes. Reports on the relation between HRV and both acute and prolonged concussion recovery are conflicting. While some authors report on differences in the low-frequency (LF) component of HRV during postural manipulations and postexercise conditions, others observe no significant differences in various HRV measures...
November 16, 2017: Clinical Physiology and Functional Imaging
https://www.readbyqxmd.com/read/29143921/dichloroacetate-induced-intracellular-acidification-in-glioblastoma-in-vivo-detection-using-aacid-cest-mri-at-9-4%C3%A2-tesla
#11
Mohammed Albatany, Alex Li, Susan Meakin, Robert Bartha
Intracellular pH (pHi) plays an important role in the maintenance of normal cell function, and is maintained within a narrow range by the activity of transporters located at the plasma membrane. Modulation of tumor pHi may influence proliferation, apoptosis, chemotherapy resistance, and thermosensitivity. Chemical exchange saturation transfer (CEST) is a novel MRI contrast mechanism that is dependent on cellular pH. Amine and amide concentration-independent detection (AACID) is a recently developed CEST contrast method that is intracellular pH (pHi) weighted...
November 16, 2017: Journal of Neuro-oncology
https://www.readbyqxmd.com/read/29143892/update-in-the-therapy-of-advanced-neuroendocrine-tumors
#12
REVIEW
Inbal Uri, Shani Avniel-Polak, David J Gross, Simona Grozinsky-Glasberg
Neuroendocrine tumors (NETs) are rare neoplasms, with an estimated annual incidence of ~ 6.9/100,000. NETs arise throughout the body from cells of the diffuse endocrine system. More than half originate from endocrine cells of the gastrointestinal tract and the pancreas, thus being referred to as gastroenteropancreatic NETs (GEP-NETs). The only treatment that offers a cure is surgery; however, most patients are diagnosed with metastatic disease, and curative surgery is usually not an option. These patients can be offered long-term systemic treatment, for both symptomatic relief and tumor growth suppression...
November 16, 2017: Current Treatment Options in Oncology
https://www.readbyqxmd.com/read/29143637/impact-of-malaria-interventions-on-child-mortality-in-endemic-african-settings-comparison-and-alignment-between-list-and-spectrum-malaria-model
#13
Eline Korenromp, Matthew Hamilton, Rachel Sanders, Guy Mahiané, Olivier J T Briët, Thomas Smith, William Winfrey, Neff Walker, John Stover
BACKGROUND: In malaria-endemic countries, malaria prevention and treatment are critical for child health. In the context of intervention scale-up and rapid changes in endemicity, projections of intervention impact and optimized program scale-up strategies need to take into account the consequent dynamics of transmission and immunity. METHODS: The new Spectrum-Malaria program planning tool was used to project health impacts of Insecticide-Treated mosquito Nets (ITNs) and effective management of uncomplicated malaria cases (CMU), among other interventions, on malaria infection prevalence, case incidence and mortality in children 0-4 years, 5-14 years of age and adults...
November 7, 2017: BMC Public Health
https://www.readbyqxmd.com/read/29143417/can-antarctic-lichens-acclimatise-to-changes-in-temperature
#14
Claudia Colesie, Burkhard Büdel, Vaughan Hurry, T G Allan Green
The Antarctic Peninsula, a tundra biome dominated by lichens and bryophytes, is an ecozone undergoing rapid temperature shifts. Such changes may demand a high physiological plasticity of the local lichen species in order for them to maintain their role as key drivers in this pristine habitat. This study examines the response of net photosynthesis and respiration to increasing temperatures for three Antarctic lichen species with different ecological response amplitudes. We hypothesise that negative effects caused by increased temperatures can be mitigated by thermal acclimation of respiration and/or photosynthesis...
November 15, 2017: Global Change Biology
https://www.readbyqxmd.com/read/29142589/flim-fret-analyzer-open-source-software-for-automation-of-lifetime-based-fret-analysis
#15
Jiho Kim, Yury Tsoy, Jan Persson, Regis Grailhe
Background: Despite the broad use of FRET techniques, available methods for analyzing protein-protein interaction are subject to high labor and lack of systematic analysis. We propose an open source software allowing the quantitative analysis of fluorescence lifetime imaging (FLIM) while integrating the steady-state fluorescence intensity information for protein-protein interaction studies. Findings: Our developed open source software is dedicated to fluorescence lifetime imaging microscopy (FLIM) data obtained from Becker & Hickl SPC-830...
2017: Source Code for Biology and Medicine
https://www.readbyqxmd.com/read/29142475/predictive-factors-associated-with-carcinoid-syndrome-in-patients-with-gastrointestinal-neuroendocrine-tumors
#16
Beilei Cai, Michael S Broder, Eunice Chang, Tingjian Yan, David C Metz
AIM: To discover unknown factors associated with carcinoid syndrome (CS) with the goal of earlier diagnosis of CS. METHODS: In this retrospective case-control study using United States administrative claims, patients (≥ 18 years) newly-diagnosed with gastrointestinal neuroendocrine tumors (GI NETs) without CS (controls) were exactly matched to patients with CS (cases) based on NET diagnosis date at a 3-to-1 ratio. Study index date was first CS diagnosis (controls: same distance from NET diagnosis as cases)...
October 28, 2017: World Journal of Gastroenterology: WJG
https://www.readbyqxmd.com/read/29142229/impact-of-deforestation-and-climate-on-the-amazon-basin-s-above-ground-biomass-during-1993-2012
#17
Jean-François Exbrayat, Yi Y Liu, Mathew Williams
Since the 1960s, large-scale deforestation in the Amazon Basin has contributed to rising global CO2 concentrations and to climate change. Recent advances in satellite observations enable estimates of gross losses of above-ground biomass (AGB) stocks due to deforestation. However, because of simultaneous regrowth, the net contribution of deforestation emissions to rising atmospheric CO2 concentrations is poorly quantified. Climate change may also reduce the potential for forest regeneration in previously disturbed regions...
November 15, 2017: Scientific Reports
https://www.readbyqxmd.com/read/29142010/value-of-progression-of-coronary-artery-calcification-for-risk-prediction-of-coronary-and-cardiovascular-events-result-of-the-heinz-nixdorf-recall-hnr-study
#18
Nils Lehmann, Raimund A Erbel, Amir A Mahabadi, Michael Rauwolf, Stefan Möhlenkamp, Susanne Moebus, Hagen Kälsch, Thomas Budde, Axel Schmermund, Andreas Stang, Dagmar Führer-Sakel, Christian Weimar, Ulla Roggenbuck, Nico Dragano, Karl-Heinz Jöckel
Background -Computed tomography (CT) allows estimation of coronary artery calcium (CAC) progression. We evaluated several progression algorithms in our unselected, population-based cohort for risk prediction of coronary and cardiovascular (CV) events. Methods -In 3281 participants (45-74 years), free from CV disease until the 2(nd) visit, risk factors and CTs at baseline (b) and after a mean of 5.1 years (5y) were measured. Hard coronary and cardiovascular events as well as total CV events including revascularization were recorded during a follow-up time of 7...
November 15, 2017: Circulation
https://www.readbyqxmd.com/read/29142006/characterization-of-neuroendocrine-tumors-in-heterozygous-mutant-menx-rats-a-novel-model-of-invasive-medullary-thyroid-carcinoma
#19
Sara Molatore, Andrea Kügler, Martin Irmler, Tobias Wiedemann, Frauke Neff, Annette Feuchtinger, Johannes Beckers, Mercedes Robledo, Frederico Roncaroli, Natalia S Pellegata
Rats affected by the MENX syndrome spontaneously develop multiple neuroendocrine tumors (NETs) including adrenal, pituitary and thyroid gland neoplasms. MENX was initially reported to be inherited as a recessive trait and affected rats were found to be homozygous for the predisposing Cdkn1b mutation encoding p27. We here report that heterozygous MENX mutant rats (p27+/mut) develop the same spectrum of NETs seen in the homozygous (p27mut/mut) animals but with slower progression. Consequently, p27+/mut rats have a significantly shorter lifespan compared with their wild-type (p27+/+) littermates...
November 15, 2017: Endocrine-related Cancer
https://www.readbyqxmd.com/read/29141726/status-of-insecticide-resistance-in-papua-new-guinea-an-update-from-nation-wide-monitoring-of-anopheles-mosquitoes
#20
Gussy Koimbu, Cyrille Czeher, Michelle Katusele, Muker Sakur, Lemen Kilepak, Anthony Tandrapah, Manuel W Hetzel, Justin Pulford, Leanne Robinson, Stephan Karl
Insecticide resistance (IR) monitoring is an important component of vector-borne disease control. The last assessment of IR in Papua New Guinea (PNG) was conducted in 2010. Since then, vector populations have been exposed to higher levels of pyrethroids with the continued nation-wide distribution of insecticide-treated nets. Here, we provide an update on phenotypic IR in four highly malaria-endemic areas of PNG. IR against deltamethrin, lambda-cyhalothrin, and dichlorodiphenyltrichloroethane was assessed using World Health Organization bioassays...
November 6, 2017: American Journal of Tropical Medicine and Hygiene
keyword
keyword
33005
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"