keyword
MENU ▼
Read by QxMD icon Read
search

antimicrobial peptide

keyword
https://www.readbyqxmd.com/read/29147555/what-can-machine-learning-do-for-antimicrobial-peptides-and-what-can-antimicrobial-peptides-do-for-machine-learning
#1
REVIEW
Ernest Y Lee, Michelle W Lee, Benjamin M Fulan, Andrew L Ferguson, Gerard C L Wong
Antimicrobial peptides (AMPs) are a diverse class of well-studied membrane-permeating peptides with important functions in innate host defense. In this short review, we provide a historical overview of AMPs, summarize previous applications of machine learning to AMPs, and discuss the results of our studies in the context of the latest AMP literature. Much work has been recently done in leveraging computational tools to design new AMP candidates with high therapeutic efficacies for drug-resistant infections...
December 6, 2017: Interface Focus
https://www.readbyqxmd.com/read/29147502/chemical-space-guided-discovery-of-antimicrobial-bridged-bicyclic-peptides-against-pseudomonas-aeruginosa-and-its-biofilms
#2
Ivan Di Bonaventura, Xian Jin, Ricardo Visini, Daniel Probst, Sacha Javor, Bee-Ha Gan, Gaëlle Michaud, Antonino Natalello, Silvia Maria Doglia, Thilo Köhler, Christian van Delden, Achim Stocker, Tamis Darbre, Jean-Louis Reymond
Herein we report the discovery of antimicrobial bridged bicyclic peptides (AMBPs) active against Pseudomonas aeruginosa, a highly problematic Gram negative bacterium in the hospital environment. Two of these AMBPs show strong biofilm inhibition and dispersal activity and enhance the activity of polymyxin, currently a last resort antibiotic against which resistance is emerging. To discover our AMBPs we used the concept of chemical space, which is well known in the area of small molecule drug discovery, to define a small number of test compounds for synthesis and experimental evaluation...
October 1, 2017: Chemical Science
https://www.readbyqxmd.com/read/29147099/changes-in-quality-characteristics-of-pork-patties-containing-antioxidative-fish-skin-peptide-or-fish-skin-peptide-loaded-nanoliposomes-during-refrigerated-storage
#3
Jing-Jing Bai, Jung-Gyu Lee, Sang-Yoon Lee, Soojin Kim, Mi-Jung Choi, Youngjae Cho
Marine fish skin peptides (FSP) have been widely studied due to their antioxidant and antimicrobial properties. We aimed to use a natural antioxidant, FSP, to replacing synthetic preservatives in a pork patty model, which is safer for human body. Moreover, nano-liposome technology can be applied for masking the fishy smell and improving the stability of this peptide. Therefore, in this study, the effects of FSP and FSP-loaded liposomes (FSPL) on pork patty were evaluated through the tests of thiobarbituric acid reactive substances (TBARS), color, cooking loss, texture, volatile basic nitrogen (VBN), and the pH value, during 14 d of refrigerated (4°C) storage...
2017: Korean Journal for Food Science of Animal Resources
https://www.readbyqxmd.com/read/29145610/transition-to-an-aquatic-habitat-permitted-the-repeated-loss-of-the-pleiotropic-klk8-gene-in-mammals
#4
Nikolai Hecker, Virag Sharma, Michael Hiller
KLK8 (also called neuropsin) is a serine protease that plays distinct roles in the skin and hippocampus. In the skin, KLK8 influences keratinocyte proliferation and desquamation, and activates antimicrobial peptides in sweat. In the hippocampus, KLK8 affects memory acquisition. Here, we examined the evolution of KLK8 in mammals and discovered that, out of 70 placental mammals, KLK8 is exclusively lost in three independent fully-aquatic lineages, comprising dolphin, killer whale, minke whale and manatee. In addition, while the sperm whale has an intact KLK8 reading frame, the gene evolves neutrally in this species...
November 14, 2017: Genome Biology and Evolution
https://www.readbyqxmd.com/read/29145473/suppression-and-resolution-of-autoimmune-arthritis-by-rhesus-%C3%AE-defensin-1-an-immunomodulatory-macrocyclic-peptide
#5
Justin B Schaal, Dat Q Tran, Akshay Subramanian, Reshma Patel, Teresina Laragione, Kevin D Roberts, Katie Trinh, Prasad Tongaonkar, Patti A Tran, Dmitriy Minond, Gregg B Fields, Paul Beringer, André J Ouellette, Percio S Gulko, Michael E Selsted
θ-defensins constitute a family of macrocyclic peptides expressed exclusively in Old World monkeys. The peptides are pleiotropic effectors of innate immunity, possessing broad spectrum antimicrobial activities and immunoregulatory properties. Here we report that rhesus θ-defensin 1 (RTD-1) is highly effective in arresting and reversing joint disease in a rodent model of rheumatoid arthritis (RA). Parenteral RTD-1 treatment of DA/OlaHsd rats with established pristane-induced arthritis (PIA) rapidly suppressed joint disease progression, restored limb mobility, and preserved normal joint architecture...
2017: PloS One
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#6
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29144391/antimicrobial-peptide-epinecidin-1-modulates-myd88-protein-levels-via-the-proteasome-degradation-pathway
#7
Bor-Chyuan Su, Jyh-Yih Chen
The cationic antimicrobial peptide epinecidin-1 was identified from Epinephelus coioides and possesses multiple biological functions, including antibacterial, antifungal, anti-tumor, and immunomodulatory effects. In addition, epinecidin-1 suppresses lipopolysaccharide (LPS)-induced inflammation by neutralizing LPS and ameliorating LPS/Toll-like receptor (TLR)-4 internalization. However, it is unclear whether the actions of epinecidin-1 depend on the regulation of TLR adaptor protein MyD88 or endogenous TLR signaling antagonists, which include A20, interleukin-1 receptor associated kinase (IRAK)-M, and suppressor of cytokine signaling (SOCS)-1...
November 16, 2017: Marine Drugs
https://www.readbyqxmd.com/read/29143452/engineering-improved-variants-of-the-antifungal-peptide-histatin-5-with-reduced-susceptibility-to-candida-albicans-secreted-aspartic-proteases-and-enhanced-antimicrobial-potency
#8
Svetlana P Ikonomova, Parisa Moghaddam-Taaheri, Mary Ann Jabra-Rizk, Yan Wang, Amy J Karlsson
Candida albicans is an opportunistic fungal pathogen and a commensal organism that commonly colonizes mucosal surfaces, including those inside the human mouth. To help control C. albicans, human saliva contains the antifungal peptide histatin 5 (Hst-5), which has strong antifungal activity against C. albicans. However, the pathogen produces secreted aspartic proteases (Saps) that cleave Hst-5 at lysine residues and eliminate its antifungal properties. We designed variants of Hst-5 with its lysine residues substituted with arginine or leucine to evaluate the effect on proteolysis by Saps...
November 15, 2017: FEBS Journal
https://www.readbyqxmd.com/read/29142299/the-immunomodulatory-drug-glatiramer-acetate-is-also-an-effective-antimicrobial-agent-that-kills-gram-negative-bacteria
#9
Stig Hill Christiansen, Ronan A Murphy, Kristian Juul-Madsen, Marlene Fredborg, Michael Lykke Hvam, Esben Axelgaard, Sandra M Skovdal, Rikke Louise Meyer, Uffe B Skov Sørensen, Arne Möller, Jens Randel Nyengaard, Niels Nørskov-Lauritsen, Mikala Wang, Mihaela Gadjeva, Kenneth A Howard, Jane C Davies, Eskild Petersen, Thomas Vorup-Jensen
Classic drug development strategies have failed to meet the urgent clinical needs in treating infections with Gram-negative bacteria. Repurposing drugs can lead to timely availability of new antibiotics, accelerated by existing safety profiles. Glatiramer acetate (GA) is a widely used and safe formulation for treatment of multiple sclerosis. It contains a large diversity of essentially isomeric polypeptides with the cationic and amphiphilic character of many antimicrobial peptides (AMP). Here, we report that GA is antibacterial, targeting Gram-negative organisms with higher activity towards Pseudomonas aeruginosa than the naturally-occurring AMP LL-37 in human plasma...
November 15, 2017: Scientific Reports
https://www.readbyqxmd.com/read/29142002/toll-like-receptor-2-has-a-prominent-but-nonessential-role-in-innate-immunity-to-staphylococcus-aureus-pneumonia
#10
Shawn J Skerrett, Marissa H Braff, H Denny Liggitt, Craig E Rubens
Staphylococcus aureus is an important cause of acute bacterial pneumonia. Toll-like receptor 2 (TLR2) recognizes multiple components of the bacterial cell wall and activates innate immune responses to gram-positive bacteria. We hypothesized that TLR2 would have an important role in pulmonary host defense against S. aureus TLR null (TLR2(-/-)) mice and wild type (WT) C57BL/6 controls were challenged with aerosolized S. aureus at a range of inocula for kinetic studies of cytokine and antimicrobial peptide expression, lung inflammation, bacterial killing by alveolar macrophages, and bacterial clearance...
November 2017: Physiological Reports
https://www.readbyqxmd.com/read/29141997/crispr-cas9-mediated-genome-editing-reveals-the-synergistic-effects-of-%C3%AE-defensin-family-members-on-sperm-maturation-in-rat-epididymis
#11
Chaobao Zhang, Yuchuan Zhou, Shengsong Xie, Qianqian Yin, Chunhua Tang, Zimei Ni, Jian Fei, Yonglian Zhang
The epididymis is a male reproductive organ involved in posttesticular sperm maturation and storage, but the mechanism underlying sperm maturation remains unclear. β-Defensins (Defbs) belong to a family of small, cysteine-rich, cationic peptides that are antimicrobial and modulate the immune response. A large number of Defb genes are expressed abundantly in the male reproductive tract, especially in the epididymis. We and other groups have shown the involvement of several Defb genes in regulation of sperm function...
November 15, 2017: FASEB Journal: Official Publication of the Federation of American Societies for Experimental Biology
https://www.readbyqxmd.com/read/29140694/tyrocidine-a-analogues-bearing-the-planar-d-phe-2-abz-turn-motif-how-conformation-impacts-bioactivity
#12
Alan J Cameron, Patrick J B Edwards, Elena Harjes, Vijayalekshmi Sarojini
The D-Phe-Pro β-turn of the cyclic β-hairpin antimicrobial decapeptide Tyrocidine A, (Tyrc A) was substituted with the D-Phe-2-aminobenzoic acid (2-Abz) motif in a synthetic analogue (1). NMR structure of 1 demonstrated that compound 1 retained the β-hairpin structure of Tyrc A with additional planarity, resulting in approx. 30-fold reduced haemolysis than Tyrc A. Although antibacterial activity was partially compromised, a single Gln to Lys substitution (2) restored activity equivalent to Tyrc A against S...
November 15, 2017: Journal of Medicinal Chemistry
https://www.readbyqxmd.com/read/29139623/extracellular-proteinases-of-candida-species-pathogenic-yeasts
#13
Maria Rapala-Kozik, Oliwia Bochenska, Dorota Zajac, Justyna Karkowska-Kuleta, Mariusz Gogol, Marcin Zawrotniak, Andrzej Kozik
The increased incidence of severe disseminated infections caused by opportunistic yeast-like fungi Candida spp. highlights the urgent need for research into the major virulence factors of these pathogens - extracellular aspartic proteinases of the candidapepsin and yapsin families. Classically, these enzymes were considered to be generally destructive factors that damage host tissues and provide nutrients for pathogen propagation. However, in recent decades, novel and more specific functions have been suggested for extracellular candidal proteinases...
November 15, 2017: Molecular Oral Microbiology
https://www.readbyqxmd.com/read/29139621/paneth-and-intestinal-stem-cells-preserve-their-functional-integrity-during-worsening-of-acute-cellular-rejection-in-small-bowel-transplantation
#14
M Pucci Molineris, V Gonzalez Polo, Federico Perez, D Ramisch, M Rumbo, G E Gondolesi, D Meier
Graft survival after small bowel transplantation remains impaired due to acute cellular rejection (ACR), the leading cause of graft loss. Although it was shown that the number of enteroendocrine progenitor cells in intestinal crypts was reduced during mild ACR, no results of Paneth and intestinal stem cells localized at the crypt bottom have been shown so far. Therefore, we wanted to elucidate integrity and functionality of the Paneth and stem cells during different degrees of ACR, and to assess whether these cells are the primary targets of the rejection process...
November 15, 2017: American Journal of Transplantation
https://www.readbyqxmd.com/read/29138537/development-of-novel-ultrashort-antimicrobial-peptide-nanoparticles-with-potent-antimicrobial-and-antibiofilm-activities-against-multidrug-resistant-bacteria
#15
Ammar Almaaytah, Gubran Khalil Mohammed, Ahmad Abualhaijaa, Qosay Al-Balas
Conventional antibiotics are facing strong microbial resistance that has recently reached critical levels. This situation is leading to significantly reduced therapeutic potential of a huge proportion of antimicrobial agents currently used in clinical settings. Antimicrobial peptides (AMPs) could provide the medical community with an alternative strategy to traditional antibiotics for combating microbial resistance. However, the development of AMPs into clinically useful antibiotics is hampered by their relatively low stability, toxicity, and high manufacturing costs...
2017: Drug Design, Development and Therapy
https://www.readbyqxmd.com/read/29138462/the-antibacterial-and-anti-inflammatory-activity-of-chicken-cathelicidin-2-combined-with-exogenous-surfactant-for-the-treatment-of-cystic-fibrosis-associated-pathogens
#16
Brandon J H Banaschewski, Brandon Baer, Christina Arsenault, Teah Jazey, Edwin J A Veldhuizen, Johan Delport, Tracey Gooyers, James F Lewis, Henk P Haagsman, Ruud A W Veldhuizen, Cory Yamashita
Cystic fibrosis (CF) is characterized by recurrent airway infections with antibiotic-resistant bacteria and chronic inflammation. Chicken cathelicin-2 (CATH-2) has been shown to exhibit antimicrobial activity against antibiotic-resistant bacteria and to reduce inflammation. In addition, exogenous pulmonary surfactant has been suggested to enhance pulmonary drug delivery. It was hypothesized that CATH-2 when combined with an exogenous surfactant delivery vehicle, bovine lipid extract surfactant (BLES), would exhibit antimicrobial activity against CF-derived bacteria and downregulate inflammation...
November 14, 2017: Scientific Reports
https://www.readbyqxmd.com/read/29138448/antimicrobial-peptides-in-frog-poisons-constitute-a-molecular-toxin-delivery-system-against-predators
#17
Constantijn Raaymakers, Elin Verbrugghe, Sophie Hernot, Tom Hellebuyck, Cecilia Betti, Cindy Peleman, Myriam Claeys, Wim Bert, Vicky Caveliers, Steven Ballet, An Martel, Frank Pasmans, Kim Roelants
Animals using toxic peptides and proteins for predation or defense typically depend on specialized morphological structures, like fangs, spines, or a stinger, for effective intoxication. Here we show that amphibian poisons instead incorporate their own molecular system for toxin delivery to attacking predators. Skin-secreted peptides, generally considered part of the amphibian immune system, permeabilize oral epithelial tissue and enable fast access of cosecreted toxins to the predator's bloodstream and organs...
November 14, 2017: Nature Communications
https://www.readbyqxmd.com/read/29138104/novel-mixed-vesicles-containing-lactobacilli-biosurfactant-for-vaginal-delivery-of-an-anti-candida-agent
#18
Angela Abruzzo, Barbara Giordani, Carola Parolin, Beatrice Vitali, Michele Protti, Laura Mercolini, Martina Cappelletti, Stefano Fedi, Federica Bigucci, Teresa Cerchiara, Barbara Luppi
The purpose of this work was to prepare and characterize an innovative formulation for vaginal delivery of econazole nitrate, commonly used for the treatment of Candida infections. A novel biosurfactant isolated from a vaginal Lactobacillus strain was used to prepare phosphatidylcholine based mixed vesicles. Biosurfactant was produced by Lactobacillus gasseri BC9, isolated from the vagina of a healthy premenopausal woman, and was chemically characterized by FT-IR and ESI-MS. Mixed vesicles, obtained through film rehydration and extrusion method, were characterized in terms of size, zeta potential, encapsulation efficiency, mucoadhesion properties and econazole release...
November 11, 2017: European Journal of Pharmaceutical Sciences
https://www.readbyqxmd.com/read/29138064/bicontinuous-microemulsions-as-a-biomembrane-mimetic-system-for-melittin
#19
Douglas G Hayes, Ran Ye, Rachel N Dunlap, Divina B Anunciado, Sai Venkatesh Pingali, Hugh M O'Neill, Volker S Urban
Antimicrobial peptides effectively kill antibiotic-resistant bacteria by forming pores in prokaryotes' biomembranes via penetration into the biomembranes' interior. Bicontinuous microemulsions, consisting of interdispersed oil and water nanodomains separated by flexible surfactant monolayers, are potentially valuable for hosting membrane-associated peptides and proteins due to their thermodynamic stability, optical transparency, low viscosity, and high interfacial area. Here, we show that bicontinuous microemulsions formed by negatively-charged surfactants are a robust biomembrane mimetic system for the antimicrobial peptide melittin...
November 11, 2017: Biochimica et Biophysica Acta
https://www.readbyqxmd.com/read/29135962/design-recombinant-fusion-expression-and-biological-evaluation-of-vasoactive-intestinal-peptide-analogue-as-novel-antimicrobial-agent
#20
Chunlan Xu, Yu Guo, Xiangjin Qiao, Xiaoya Shang, Weining Niu, Mingliang Jin
Antimicrobial peptides represent an emerging category of therapeutic agents with remarkable structural and functional diversity. Modified vasoactive intestinal peptide (VIP) (VIP analogue 8 with amino acid sequence "FTANYTRLRRQLAVRRYLAAILGRR") without haemolytic activity and cytotoxicity displayed enhanced antimicrobial activities against Staphylococcus aureus (S. aureus) ATCC 25923 and Escherichia coli (E. coli) ATCC 25922 than parent VIP even in the presence of 180 mM NaCl or 50 mM MgCl₂, or in the range of pH 4-10...
November 14, 2017: Molecules: a Journal of Synthetic Chemistry and Natural Product Chemistry
keyword
keyword
32828
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"