keyword
MENU ▼
Read by QxMD icon Read
search

Chia

keyword
https://www.readbyqxmd.com/read/28092801/the-association-between-personal-income-and-aging-a-population-based-13-year-longitudinal-study
#1
Tzu-Yu Lin, Chia-Yu Chen, Chueh-Yung Tsao, Kuang-Hung Hsu
INTRODUCTION: Population aging is set to increase the elder dependency ratio, causing a rapid increase in healthcare expenditures and financial burden on the government. This study aims to construct an aging score from age-related diseases and to perform longitudinal analyses to examine the association between personal income and aging. METHODS: A total of 86,838 subjects drawn from a community with 384,617 residents in northern Taiwan were examined. Personal income and aging-related diseases were measured from the National Health Insurance database during 1997-2010...
January 9, 2017: Archives of Gerontology and Geriatrics
https://www.readbyqxmd.com/read/28092584/temporally-coherent-illumination-normalization-for-indocyanine-green-video-angiography
#2
Wei-Yang Lin, Shu-Fu Chou, Chia-Ling Tsai, Shih-Jen Chen
Indocyanine green (ICG) angiography is an imaging method for Doctors to observe choroidal abnormalities in human eyes. The ICG angiograms typically exhibit inhomogeneous illumination which poses serious difficulties for the development of computer-aided diagnostic tools. In this paper, we propose a novel illumination normalization method to alleviate the inhomogeneous illumination in ICG video angiograms. In particular, we first align the viewpoint of the input ICG video angiogram using an image registration method...
January 16, 2017: IEEE Journal of Biomedical and Health Informatics
https://www.readbyqxmd.com/read/28092436/single-upconversion-nanoparticle-bacterium-cotrapping-for-single-bacterium-labeling-and-analysis
#3
Hongbao Xin, Yuchao Li, Dekang Xu, Yueli Zhang, Chia-Hung Chen, Baojun Li
Detecting and analyzing pathogenic bacteria in an effective and reliable manner is crucial for the diagnosis of acute bacterial infection and initial antibiotic therapy. However, the precise labeling and analysis of bacteria at the single-bacterium level are a technical challenge but very important to reveal important details about the heterogeneity of cells and responds to environment. This study demonstrates an optical strategy for single-bacterium labeling and analysis by the cotrapping of single upconversion nanoparticles (UCNPs) and bacteria together...
January 16, 2017: Small
https://www.readbyqxmd.com/read/28089894/determining-the-cleavage-site-for-the-mature-antimicrobial-peptide-of-nile-tilapia-%C3%AE-defensin-using-2d-electrophoresis-western-blot-and-mass-spectrometry-analysis
#4
Chin-I Chang, Li-Hao Chen, Yeh-Fang Hu, Chia-Che Wu, Jyh-Ming Tsai
Several proteomic techniques were used to determine the cleavage site of the mature antimicrobial peptide of Nile tilapia β-defensin. The computer-predicted Nile tilapia β-defensin ((25)ASFPWSCLSLSGVCRKVCLPTELFFGPLGCGKGSLCCVSHFL(66)) composed of 42 amino acids was chemically synthesized and prepared to produce an antibody for Western blotting. Total proteins from the skin of the Nile tilapia were separated on two-dimensional electrophoresis, and the spot of Nile tilapia β-defensin was recognized using Western blot analysis...
January 9, 2017: Fish & Shellfish Immunology
https://www.readbyqxmd.com/read/28089494/downregulation-of-mir-1-enhances-tumorigenicity-and-invasiveness-in-oral-squamous-cell-carcinomas
#5
Chih-Yu Peng, Yi-Wen Liao, Ming-Yi Lu, Chuan-Hang Yu, Cheng-Chia Yu, Ming-Yung Chou
BACKGROUND/PURPOSE: Cumulative evidence suggest that microRNAs (miRNAs) function as biosignatures of oral squamous cell carcinomas (OSCC). However, the functional roles of miR-1 as well as its downstream targets in the regulation of tumorigenicity in OSCC remain unclear. METHODS: miRNAs RT-PCR analysis was performed to identify miR-1 as a putative candidate on mediating invasiveness of OSCC cells. Consequently, we elucidated the tumorigenicity of OSCC cells with miR-1 downregulation or overexpression, respectively...
January 12, 2017: Journal of the Formosan Medical Association, Taiwan Yi Zhi
https://www.readbyqxmd.com/read/28089100/community-onset-clostridium-difficile-infection-at-a-tertiary-medical-center-in-southern-taiwan-2007-2015
#6
Chin-Shiang Tsai, Yuan-Pin Hung, Jen-Chieh Lee, Nan-Yao Lee, Po-Lin Chen, Ling-Shan Syue, Ming-Chi Li, Chia-Wen Li, Wen-Chien Ko
BACKGROUND: Clostridium difficile infection (CDI) is well-known as the major cause of infectious diarrhea in hospitalized patients. Community-onset CDI (CO-CDI) is an emerging threat. However, clinical information of CO-CDI in Taiwan remains scarce. METHODS: A retrospective study was conducted at a medical center in southern Taiwan. Symptomatic patients between 2007 and 2015 with C. difficile toxin or tcdB detected in stool were identified as CDI, and were classified as CO-CDI [including community-associated CDI (CA-CDI) and community-onset health care facility-associated CDI (CO-HCFA-CDI)] and health care facility-onset CDI (HCFO-CDI)...
December 18, 2016: Journal of Microbiology, Immunology, and Infection, Wei Mian Yu Gan Ran za Zhi
https://www.readbyqxmd.com/read/28089080/salba-chia-salvia-hispanica-l-in-the-treatment-of-overweight-and-obese-patients-with-type-2-diabetes-a-double-blind-randomized-controlled-trial
#7
V Vuksan, A L Jenkins, C Brissette, L Choleva, E Jovanovski, A L Gibbs, R P Bazinet, F Au-Yeung, A Zurbau, H V T Ho, L Duvnjak, J L Sievenpiper, R G Josse, A Hanna
BACKGROUND AND AIM: Preliminary findings indicate that consumption of Salba-chia (Salvia hispanica L.), an ancient seed, improves management of type 2 diabetes and suppresses appetite. The aim of this study was to assesse the effect of Salba-chia on body weight, visceral obesity and obesity-related risk factors in overweight and obese adults with type 2 diabetes. METHODS: A double-blind, randomized, controlled trial with two parallel groups involved 77 overweight or obese patients with type 2 diabetes (HbA1c: 6...
December 9, 2016: Nutrition, Metabolism, and Cardiovascular Diseases: NMCD
https://www.readbyqxmd.com/read/28088290/could-post-weaning-dietary-chia-seed-mitigate-the-development-of-dyslipidemia-liver-steatosis-and-altered-glucose-homeostasis-in-offspring-exposed-to-a-sucrose-rich-diet-from-utero-to-adulthood
#8
M A Fortino, M E Oliva, S Rodriguez, Y B Lombardo, A Chicco
The present work analyzes the effects of dietary chia seeds during postnatal life in offspring exposed to a sucrose-rich diet (SRD) from utero to adulthood. At weaning, chia seed (rich in α-linolenic acid) replaced corn oil (rich in linoleic acid) in the SRD. At 150 days of offspring life, anthropometrical parameters, blood pressure, plasma metabolites, hepatic lipid metabolism and glucose homeostasis were analyzed. Results showed that chia was able to prevent the development of hypertension, liver steatosis, hypertriglyceridemia and hypercholesterolemia...
January 2017: Prostaglandins, Leukotrienes, and Essential Fatty Acids
https://www.readbyqxmd.com/read/28088273/a-real-world-impact-of-cost-effectiveness-of-pegylated-interferon-ribavarin-regimens-on-treatment-na%C3%A3-ve-chronic-hepatitis-c-patients-in-taiwan
#9
Pei-Chien Tsai, Ta-Wei Liu, Meng-Hsuan Hsieh, Ming-Lun Yeh, Po-Cheng Liang, Yi-Hung Lin, Ching-I Huang, Chung-Feng Huang, Ming-Yen Hsieh, Nai-Jen Hou, Zu-Yau Lin, Shinn-Cherng Chen, Jee-Fu Huang, Chia-Yen Dai, Wan-Long Chuang, Ming-Lung Yu
Treatments with pegylated interferon/ribavirin (PEG-IFN/RBV) has been standard-of-care in patients with chronic hepatitis C virus (HCV) (CHC) infection and reimbursed in Taiwan. However, the actual cost-effectiveness remains unclear. We aimed to evaluate a real-world cost-effectiveness for CHC patients treated with PEG-IFN/RBV by using a clinical cohort with linkage to the National Health Insurance Research Database of Taiwan. The total and itemized medical-care expenses of outpatient visits of 117 treatment-naïve CHC patients with linkage to the two million sampling of the National Health Insurance Research Database were collected...
January 2017: Kaohsiung Journal of Medical Sciences
https://www.readbyqxmd.com/read/28087975/screening-and-treating-helicobacter-pylori-infection-for-gastric-cancer-prevention-on-the-population-level
#10
REVIEW
Yi-Chia Lee, Jaw-Town Lin
Helicobacter pylori infection is the major cause of gastric cancer, and removal of H. pylori infection from a population could theoretically decrease the number of cases by about 89%. However, in real-life settings, few studies have reported the effect of screening and treating this pathogen in population-based programs. This is mainly because of the lack of an adequate infrastructure for delivery of systematic screening services to asymptomatic individuals, the lack of standardization to ensure that each subject receives the correct diagnostic testing and antibiotic treatment, and limited resources...
January 14, 2017: Journal of Gastroenterology and Hepatology
https://www.readbyqxmd.com/read/28087714/dlg5-connects-cell-polarity-and-hippo-signaling-protein-networks-by-linking-par-1-with-mst1-2
#11
Julian Kwan, Anna Sczaniecka, Emad Heidary Arash, Liem Nguyen, Chia-Chun Chen, Srdjana Ratkovic, Olga Klezovitch, Liliana Attisano, Helen McNeill, Andrew Emili, Valeri Vasioukhin
Disruption of apical-basal polarity is implicated in developmental disorders and cancer; however, the mechanisms connecting cell polarity proteins with intracellular signaling pathways are largely unknown. We determined previously that membrane-associated guanylate kinase (MAGUK) protein discs large homolog 5 (DLG5) functions in cell polarity and regulates cellular proliferation and differentiation via undefined mechanisms. We report here that DLG5 functions as an evolutionarily conserved scaffold and negative regulator of Hippo signaling, which controls organ size through the modulation of cell proliferation and differentiation...
December 15, 2016: Genes & Development
https://www.readbyqxmd.com/read/28087349/combination-of-multiple-ligation-dependent-probe-amplification-and-illumina-miseq-amplicon-sequencing-for-tsc1-tsc2-gene-analyses-in-patients-with-tuberous-sclerosis-complex
#12
Nur Farrah Dila Ismail, Abdul Qawee Rani, Nik Mohd Ariff Nik Abdul Malik, Chia Boon Hock, Siti Nabilahuda Mohd Azlan, Salmi Abdul Razak, Wee Teik Keng, Lock Hock Ngu, Abdul Rashid Silawati, Nor AzniYahya, Narazah Mohd Yusoff, Teguh Haryo Sasongko, Zabidi Azhar Mohd Hussin
Tuberous sclerosis complex (TSC) is an autosomal dominant neurocutaneous disorder characterized by tumor growth in multiple organs and caused by mutations in either TSC1 or TSC2 genes. Because of their relatively large genomic sizes, absence of hotspots, and common type of mutations, mutation detection in TSC1 and TSC2 genes has been challenging. We devised a combination of multiple ligation-dependent probe amplification (MLPA) and amplicon sequencing (AS) to simplify the detection strategy, yet we come up with reasonably high detection rate...
January 10, 2017: Journal of Molecular Diagnostics: JMD
https://www.readbyqxmd.com/read/28087317/acute-otitis-media-caused-by-streptococcus-pneumoniae-serotype-19a-st320-clone-epidemiological-and-clinical-characteristics
#13
Hsin Chi, Nan-Chang Chiu, Fu-Yuan Huang, Chyong-Hsin Hsu, Kuo-Sheng Lee, Li-Min Huang, Yu-Chia Hsieh
BACKGROUND: Streptococcus pneumoniae serotype 19A ST320, a highly multiresistant and virulent clone, has emerged as a common pathogen causing acute otitis media (AOM) in children. METHODS: Patients aged 0-18 years with AOM who presented at Mackay Memorial Hospital, Taipei, Taiwan were prospectively enrolled between December 1, 2009, and November 30, 2012. For each patient, a specimen of middle-ear fluid was obtained and cultured. S. pneumoniae isolates were tested by serotyping, antibiotic-resistance profiling, and multilocus sequence typing...
December 19, 2016: Journal of Microbiology, Immunology, and Infection, Wei Mian Yu Gan Ran za Zhi
https://www.readbyqxmd.com/read/28087203/the-use-of-modified-ride-on-cars-to-maximize-mobility-and-improve-socialization-a-group-design
#14
Hsiang-Han Huang, Chia-Ling Chen
AIM: To examine the effects of ride-on car (ROC) training versus conventional therapy on mobility and social function in young children with disabilities in a hospital-based environment. METHODS AND PROCEDURES: Twenty young children with disabilities, aged 1-3 years, were recruited. The treatment group (n=10) received ROC training of 2h/session, 2 sessions/week for a total of 9 weeks in the hospital environment. The control group (n=10) received conventional therapy alone...
January 10, 2017: Research in Developmental Disabilities
https://www.readbyqxmd.com/read/28087179/value-of-serum-n-terminal-b-type-natriuretic-peptide-in-asymptomatic-structural-heart-disease-in-taiwanese-population-comparisons-with-current-esc-guidelines
#15
Ta-Chuan Hung, Kuang-Te Wang, Chun-Ho Yun, Jen-Yuan Kuo, Charles Jia-Yin Hou, Chia-Yuan Liu, Tung-Hsin Wu, Hiram G Bezerra, Hsiao-Yang Cheng, Chung-Lieh Hung, Hung-I Yeh
BACKGROUND: The relationship between N-terminal pro-brain natriuretic peptide (NT-proBNP) and cardiac structural or functional anomalies in pre-clinical, asymptomatic Asian populations has not been well identified. METHODS: From October 2005 to March 2008, we enrolled consecutive asymptomatic adults with preserved global left ventricular (LV) function (ejection fraction>50%) who underwent annual cardiovascular health survey. Circulating NT-proBNP was used to identify echo-defined cardiac structural/functional anomalies and compared to current recommended cut-off from the European Society of Heart Failure...
December 29, 2016: International Journal of Cardiology
https://www.readbyqxmd.com/read/28081258/the-effect-of-individual-and-neighbourhood-socioeconomic-status-on-diabetes-mellitus-survival-in-working-age-patients-in-taiwan
#16
Shih-Hsien Yang, Su-Feng Chen, Shin Nieh, Chia-Lin Liu, Yaoh-Shiang Lin, Ching-Chih Lee, Fu-Huang Lin
PURPOSE: Diabetes mellitus (DM) is a global pandemic metabolic disorder. In recent years, the amount of medical resources required for the treatment of diabetes has increased as diabetes rates have gradually risen. The combined effects of individual and neighbourhood socio-economic status (SES) on DM survival rates are still not clear, especially in patients of working age. In this paper, we aim to analyze the combined effects of neighbourhood and individual SES on DM survival rates in patients of working age in Taiwan...
2017: PloS One
https://www.readbyqxmd.com/read/28081247/changes-of-oxidative-stress-glutathione-and-its-dependent-antioxidant-enzyme-activities-in-patients-with-hepatocellular-carcinoma-before-and-after-tumor-resection
#17
Shao-Bin Cheng, Hsiao-Tien Liu, Sin-Yuan Chen, Ping-Ting Lin, Chia-Yu Lai, Yi-Chia Huang
The changes in and relationship between oxidative stress and the glutathione (GSH) antioxidant system in the plasma and tissues of patients with hepatocellular carcinoma (HCC) before and after tumor resection have not been clearly determined. We investigated the changes in oxidative stress, GSH status and its dependent antioxidant enzyme activities in HCC patients before and after tumor resection, and to determine the association of oxidative stress with GSH and its dependent antioxidant enzyme activities in plasma and tissues...
2017: PloS One
https://www.readbyqxmd.com/read/28081171/a-higher-proportion-of-metabolic-syndrome-in-chinese-subjects-with-sleep-disordered-breathing-a-case-control-study-based-on-electrocardiogram-derived-sleep-analysis
#18
Ping-Huei Tseng, Pei-Lin Lee, Wei-Chung Hsu, Yan Ma, Yi-Chia Lee, Han-Mo Chiu, Yi-Lwun Ho, Ming-Fong Chen, Ming-Shiang Wu, Chung-Kang Peng
OBJECTIVE: The prevalence of metabolic syndrome (MS) has increased rapidly in Taiwan and worldwide. We aim to determine the association between sleep-disordered breathing (SDB) and MS in a Chinese general population. METHODS: This case-control study recruited subjects who have undergone a prospective electrocardiogram-based cardiopulmonary coupling (CPC) sleep spectrogram as part of the periodic health check-ups at the National Taiwan University Hospital. Comprehensive anthropometrics, blood biochemistry, prevalence of MS and its individual components were compared with Bonferroni correction between 40 subjects with SDB, defined as the CPC-derived apnea-hypopnea index (CPC-AHI) >5 event/hour and 80 age- and sex-matched controls, defined as CPC-AHI <1 event/hour...
2017: PloS One
https://www.readbyqxmd.com/read/28081154/sensitization-of-radioresistant-prostate-cancer-cells-by-resveratrol-isolated-from-arachis-hypogaea-stems
#19
Yu-An Chen, Hsiu-Man Lien, Min-Chuan Kao, U-Ging Lo, Li-Chiung Lin, Chun-Jung Lin, Sheau-Jiun Chang, Chia-Chang Chen, Jer-Tsong Hsieh, Ho Lin, Chih-Hsin Tang, Chih-Ho Lai
Resveratrol (RV, 3,4',5-trihydroxystilbene) is naturally produced by a wide variety of plants including grapes and peanuts (Arachis hypogaea). However, the yield of RV from peanut stem and its potential radiosensitizing effects in prostate cancer (PCa) have not been well investigated. In this study, we characterized RV in peanut stem extract (PSE) for the first time and showed that both RV and PSE dose-dependently induced cell death in DOC-2/DAB2 interactive protein (DAB2IP)-deficient PCa cells with the radioresistant phenotype...
2017: PloS One
https://www.readbyqxmd.com/read/28080150/motives-matter-motives-for-playing-pok%C3%A3-mon-go-and-implications-for-well-being
#20
Chia-Chen Yang, Dong Liu
Mobile games such as Pokémon Go have become a major form of entertainment, and yet little is known about why people play the games and how their motives associate with well-being. Although literature on motives for playing video and online games is informative, the findings may not reflect the full spectrum of mobile gaming motives due to some unique affordances of mobile games (e.g., mobility). To catch up with the evolving gaming context, a popular mobile game, Pokémon Go, was taken as an example to explore individuals' mobile gaming motives...
January 2017: Cyberpsychology, Behavior and Social Networking
keyword
keyword
29234
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"