Read by QxMD icon Read

Bear paws

Łukasz Łapaj, Adrian Mróz, Paweł Kokoszka, Jacek Markuszewski, Justyna Wendland, Celina Helak-Łapaj, Jacek Kruczyński
Background and purpose - Severe backside wear, observed in older generations of total knee replacements (TKRs), led to redesign of locking mechanisms to reduce micromotions between tibial tray and inlay. Since little is known about whether this effectively reduces backside wear in modern designs, we examined backside damage in retrievals of various contemporary fixed-bearing TKRs. Patients and methods - A consecutive series of 102 inlays with a peripheral (Stryker Triathlon, Stryker Scorpio, DePuy PFC Sigma, Aesculap Search Evolution) or dovetail locking mechanism (Zimmer NexGen, Smith and Nephew Genesis II) was examined...
October 26, 2016: Acta Orthopaedica
Mateusz Baca, Danijela Popović, Krzysztof Stefaniak, Adrian Marciszak, Mikołaj Urbanowski, Adam Nadachowski, Paweł Mackiewicz
The cave bear (Ursus spelaeus sensu lato) is a typical representative of Pleistocene megafauna which became extinct at the end of the Last Glacial. Detailed knowledge of cave bear extinction could explain this spectacular ecological transformation. The paper provides a report on the youngest remains of the cave bear dated to 20,930 ± 140 (14)C years before present (BP). Ancient DNA analyses proved its affiliation to the Ursus ingressus haplotype. Using this record and 205 other dates, we determined, following eight approaches, the extinction time of this mammal at 26,100-24,300 cal...
December 2016: Die Naturwissenschaften
Alicja E Grzegorzewska, Monika K Świderska, Adrianna Mostowska, Wojciech Warchoł, Paweł P Jagodziński
AIM: To investigate circulating IFN-λ3 and IFNL3 polymorphisms in hemodialysis (HD) patients differing in HBV surface antigen antibody (anti-HBs) production. METHODS: The study included 106 HBV-vaccinated HD patients (88 developed anti-HBs) and 36 HBV-infected HD subjects (27 developed anti-HBs). Plasma IFN-λ3 (enzyme-linked immunosorbent assay) and rs12979860 (C>T) and rs8099917 (T>G) in IFNL3 (high-resolution melting curve analysis) were analyzed with regard to the association with anti-HBs production in response to HBV vaccination or infection...
September 22, 2016: Vaccine
Takehiko Maeda, Daisuke Yamada, Kohichi Kawahara
Cancer-induced bone pain (CIBP) is the most common pain arising from cancer and is inadequately managed with current standard therapeutics. While the etiology of CIBP remains to be fully elucidated, increasing evidence suggests that CIBP is uniquely complex. We tested whether semaphorin 3A (Sema3A) signals were involved in the development of CIBP in mice. The mouse model employed for CIBP - mice inoculated with Lewis lung carcinoma (LLC) cells injected into the femur intramedullary space - showed progressive decline in the weight bearing of the ipsilateral hind limb...
October 6, 2016: Neuroscience Letters
Patricia Salisbury, Layla Hall, Sibylla Kulkus, Moo Kho Paw, Nay Win Tun, Aung Myat Min, Kesinee Chotivanich, Somjet Srikanok, Pranee Ontuwong, Supachai Sirinonthachai, François Nosten, Shawn Somerset, Rose McGready
BACKGROUND: Lack of data in marginalized populations on knowledge, attitudes and practices (KAP) hampers efforts to improve modern contraceptive practice. A mixed methods study to better understand family planning KAP amongst refugee and migrant women on the Thailand-Myanmar border was conducted as part of an ongoing effort to improve reproductive health, particularly maternal mortality, through Shoklo Malaria Research Unit (SMRU) antenatal and birthing services. METHODS: Cross-sectional surveys and focus group discussions (FGDs) in currently pregnant women; and in-depth interviews (IDIs) in selected post-partum women with three children or more; were conducted...
2016: Reproductive Health
James J Burston, Paul I Mapp, Sarir Sarmad, David A Barrett, Micah J Niphakis, Benjamin F Cravatt, David A Walsh, Victoria Chapman
BACKGROUND AND PURPOSE: Chronic pain is often a symptom of knee osteoarthritis (OA) for which current analgesics are either inadequate or are associated with serious side effects. The endocannabinoid system may offer alternative targets for pain relief. We evaluated the effects of a potent and selective monoacylglycerol (MAG) lipase inhibitor (MJN110) on OA pain behaviour, spinal mechanisms of action and joint histopathology in the rat. EXPERIMENTAL APPROACH: Intra-articular injection of monosodium iodoacetate (MIA) models OA pain and mimics clinical joint pathology...
November 2016: British Journal of Pharmacology
Romeo Ngoune, Annette Peters, Dominik von Elverfeldt, Karl Winkler, Gerhard Pütz
Nanoparticle-based drug delivery to ease anticancer therapy relies primarily on the enhanced permeability and retention effect (EPR). The leaky vascular structure in tumors allows extravasation of nanoparticles, often termed passive targeting. Long term retention of nanoparticles is attributed to the lack of lymphatic drainage, and unidirectional extravasation has been implied. Fluorescent liposomes with a plasma half-life of 29h were injected into tumor-bearing rats, and biodistribution in tumor, skin, paws and ears was monitored via in vivo fluorescence measurements...
September 28, 2016: Journal of Controlled Release: Official Journal of the Controlled Release Society
Paweł Jałoszyński
Examination of the type species of Napoconnus, Himaloconnus and Nepaloconnus, taxa previously placed as subgenera of Euconnus, revealed characters remarkably different from those diagnostic for Euconnus. Napoconnus and Himaloconnus have narrowly separated metacoxae, with the metaventral intercoxal process bearing a pair of long and pointed spines touching at middle; this character alone excludes these taxa from Euconnus. Consequently, Napoconnus and Himaloconnus are elevated to the genus rank and redefined...
2016: Zootaxa
Zhi-Hong Wen, Chi-Chieh Tang, Yi-Chen Chang, Shi-Ying Huang, Yen-You Lin, Shih-Peng Hsieh, Hsin-Pai Lee, Sung-Chun Lin, Wu-Fu Chen, Yen-Hsuan Jean
We investigated the role of the calcitonin (Miacalcin) in the progression of osteoarthritis (OA) and in nociceptive behavior in an experimental rat model of OA and osteoporosis. OA was induced by anterior cruciate ligament transection (ACLT) of the right knee and by bilateral ovariectomy (OVX) in Wistar rats. Nociceptive behaviors (secondary mechanical allodynia and weight-bearing distribution of the hind paws) were analyzed prior to surgery and every week, beginning at 12 weeks after surgery, up to 20 weeks...
2016: Scientific Reports
Paweł Mielniczek, Grzegorz Zieliński, Andrzej Koziarski
Due to a high mortality rate, headshot injuries pose serious diagnostic and clinical problems. In this work, we wanted to describe four atypical headshot injuries. The first patient with a headshot injury using a nail gun mishap; the second one after a headshot injury, as a result of attempted murder (the bullet came to a parasagittal halt in the left parietal area); the third victim, after a suicide attempt (the bullet was removed from clivus area, below the pituitary gland); in the case of the fourth patient, after shooting himself with a self-constructed weapon in the chin, the metal body was surgically removed - a bearing pellet from the corpus callosum...
May 2016: Polski Merkuriusz Lekarski: Organ Polskiego Towarzystwa Lekarskiego
Sanjay B Bari, Sandip D Firake
BACKGROUND: The present study reports the synthesis and biological evaluation of thiazolidinone derivatives bearing benzenesulfonamide investigated for cyclooxygenase-2 (COX-2) inhibitory activity and in vivo anti-inflammatory activity. METHODS: The synthesis of 4-(4-oxo-2-substituted-1,3-thiazolidin-3-yl) benzenesulfonamide derivatives were carried out by conventional synthesis, involves the one-pot condensation reaction of sulfanilamide. The synthesized compounds were evaluated against COX-1 and human recombinant COX-2 by using colorimetric enzyme assay kit and in-vivo study was carried out by carageenan induced rat paw edema method...
May 24, 2016: Anti-inflammatory & Anti-allergy Agents in Medicinal Chemistry
Thomas Pitcher, João Sousa-Valente, Marzia Malcangio
A major symptom of patients with osteoarthritis (OA) is pain that is triggered by peripheral as well as central changes within the pain pathways. The current treatments for OA pain such as NSAIDS or opiates are neither sufficiently effective nor devoid of detrimental side effects. Animal models of OA are being developed to improve our understanding of OA-related pain mechanisms and define novel pharmacological targets for therapy. Currently available models of OA in rodents include surgical and chemical interventions into one knee joint...
2016: Journal of Visualized Experiments: JoVE
Yu'e Sun, Juan Zhang, Yishan Lei, Cui'e Lu, Bailing Hou, Zhengliang Ma, Xiaoping Gu
OBJECTIVES: In the present study, we investigate the effects of Mas oncogene-related gene (Mrg) C receptors (MrgC) on the expression and activation of spinal Gi protein, N-methyl-D-aspartate receptor subunit 2B (NR2B), and neuronal nitric oxide synthase (nNOS) in mouse model of bone cancer pain. METHODS: The number of spontaneous foot lift (NSF) and paw withdrawal mechanical threshold (PWMT) were measured after inoculation of tumor cells and intrathecal injection of MrgC agonist bovine adrenal medulla 8-22 (BAM8-22) or MrgC antagonist anti-MrgC for 14 days after operation...
2016: American Journal of Translational Research
Yufeng Tian, Wenlin Chen, Guoxiang Mo, Ran Chen, Mingqian Fang, Gabriel Yedid, Xiuwen Yan
Ixodid ticks are well known for spreading transmitted tick-borne pathogens while being attached to their hosts for almost 1-2 weeks to obtain blood meals. Thus, they must secrete many immunosuppressant factors to combat the hosts' immune system. In the present work, we investigated an immunosuppressant peptide of the hard tick Amblyomma variegatum. This peptide, named amregulin, is composed of 40 residues with an amino acid sequence of HLHMHGNGATQVFKPRLVLKCPNAAQLIQPGKLQRQLLLQ. A cDNA of the precursor peptide was obtained from the National Center for Biotechnology Information (NCBI, Bethesda, MD, USA)...
2016: Toxins
Sadaf Ashraf, Karyn S Bouhana, Jed Pheneger, Steven W Andrews, David A Walsh
BACKGROUND: Inflammation is an essential component of arthritis pain. Nerve growth factor (NGF) plays a key role in acute and chronic pain states especially those associated with inflammation. NGF acts through tropomyosin-receptor-kinase A (TrkA). NGF blockade has reduced arthritis pain in clinical trials. We explored the mechanisms within the joint which may contribute to the analgesic effects of NGF by selectively inhibiting TrkA in carrageenan-induced or collagen-induced joint pain behaviour...
2016: Arthritis Research & Therapy
Anna Lesniak, Marta Bochynska-Czyz, Mariusz Sacharczuk, Sandor Benhye, Aleksandra Misicka, Magdalena Bujalska-Zadrozny, Andrzej W Lipkowski
The search for new drugs for cancer pain management has been a long-standing goal in basic and clinical research. Classical opioid drugs exert their primary antinociceptive effect upon activating opioid receptors located in the central nervous system. A substantial body of evidence points to the relevance of peripheral opioid receptors as potential targets for cancer pain treatment. Peptides showing limited blood-brain-barrier permeability promote peripheral analgesia in many pain models. In the present study we examined the peripheral and central analgesic effect of intravenously administered biphalin - a dimeric opioid peptide in a mouse skin cancer pain model, developed by an intraplantar inoculation of B16F0 melanoma cells...
June 30, 2016: European Journal of Pharmaceutical Sciences
Krystyna Księżopolska-Orłowska, Anna Pacholec, Joanna Bugajska, Teresa Sadura-Sieklucka, Katarzyna Kowalik, Karolina Pawłowska-Cyprysiak, Elżbieta Łastowiecka-Moras
BACKGROUND: This study aimed to compare the effectiveness of conventional and cryotherapy-based rehabilitation with respect to its impact on selected clinical parameters in AS patients. MATERIAL AND METHODS: Fifty working males aged 22-66 years were included in this study. Twenty-five of them underwent cryotherapy-based rehabilitation (cryogenic chamber, local cryotherapy; individual, instrumental, and nonweight-bearing exercises) for 3 weeks. The others received 3 weeks of conventional rehabilitation (magnetic field therapy; electrotherapy; individual and instrumental exercises)...
January 2016: Ortopedia, Traumatologia, Rehabilitacja
Ilona Grabowska-Jadach, Marcin Drozd, Joanna Biegala, Mariusz Pietrzak, Marta Mazurkiewicz-Pawlicka, Paweł G Parzuchowski, Zbigniew Brzózka
The presented studies aimed at investigation of the effect of CdSeS/ZnS quantum dots (QDs) stabilized with hyperbranched polyglycidol and its carboxylated derivative on adenocarcinomic human alveolar basal epithelial cells (A549). The first stage of studies concerned the modification of quantum dots with both types of the tested polymers with the use of pyridine as an intermediate agent. Subsequently, cytotoxic effect of the prepared nanoparticles was examined after various incubation time using MTT test (cell metabolic activity assay)...
August 5, 2016: Journal of Pharmaceutical and Biomedical Analysis
Yongguang Xu, Gongming Wang, Xuli Zou, Zaiqi Yang, Qin Wang, Hao Feng, Mengyuan Zhang
It has previously been suggested that the upregulation of GluN2B-containing N-methyl D-aspartate receptors (GluN2B) within the rostral anterior cingulate cortex (rACC) may contribute to the development of chronic pain. The present study used a rat model of bone cancer pain in order to investigate whether lentiviral-mediated delivery of small interfering RNAs targeting GluN2B (LV-GluN2B) could attenuate pain associated with bone cancer, by selectively decreasing GluN2B expression within the rACC. Sprague Dawley rats were inoculated with osteosarcoma cells into the intramedullary space of the right tibia in order to induce persistent bone cancer-associated pain...
January 2016: Experimental and Therapeutic Medicine
Sujeet Kumar Gupta, Ashutosh Mishra
BACKGROUND: Non-steroidal anti-inflammatory drugs (NSAIDS) are clinically used as anti-inflammatory, analgesic and antipyretic agents but they have the drawbacks of causing gastric irritation and gastric ulceration. Recently, quinoline derivatives have shown significant anti-inflammatory and less ulcerogenic activity. The present study deals with the synthesis and pharmacological assessment of a series of novel quinoline derivatives bearing azetidinones scaffolds as anti-inflammatory and analgesic agents...
February 10, 2016: Anti-inflammatory & Anti-allergy Agents in Medicinal Chemistry
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"