keyword
MENU ▼
Read by QxMD icon Read
search

#MRSA

keyword
https://www.readbyqxmd.com/read/29156865/antibacterial-resistance-patterns-and-incidence-of-hospital-acquired-staphylococcus-aureus-bacteremia-in-a-tertiary-care-educational-hospital-in-turkey-a-perspective-from-2001-to-2013
#1
Oğuz Reşat Sipahi, Serhat Uysal, Sabire Şöhret Aydemir, Hüsnü Pullukçu, Meltem Taşbakan, Alper Tünger, Fatma Feriha Çilli, Tansu Yamazhan, Bilgin Arda, Hilal Sipahi, Sercan Ulusoy
Background/aim: Staphylococcus aureus is an important nosocomial pathogen and a successful antimicrobial-resistance developer. In this study we retrospectively evaluated the resistance patterns and incidence of microbiologically confirmed nosocomial bacteremia (MCNB) related S. aureus strains between 2001 and 2013. Materials and methods: Any patient in whom S. aureus was isolated in at least one set of blood cultures (sent to the bacteriology laboratory 72 h after hospital admission) was considered to have MCNB...
August 23, 2017: Turkish Journal of Medical Sciences
https://www.readbyqxmd.com/read/29155125/virulence-characteristics-and-molecular-relatedness-of-methicillin-resistant-staphylococcus-aureus-harboring-different-staphylococcal-cassette-chromosome-mec
#2
Rana El-Baz, Dina E Rizk, Rasha Barwa, Ramadan Hassan
INTRODUCTION: Methicillin resistant Staphylococcus aureus (MRSA) is a versatile pathogen capable of causing multitude of human diseases. It is one of the most important nosocomial pathogen that implicated in community and healthcare associated infections. Therefore, this study aims to characterize different SCCmec elements found in MRSA isolates. Moreover, molecular typing were performed to investigate the genetic relatedness among MRSA isolates. METHODS: Phenotypic identification of MRSA was done by disc diffusion method...
November 15, 2017: Microbial Pathogenesis
https://www.readbyqxmd.com/read/29154746/in-vitro-and-in-vivo-activity-of-fosfomycin-alone-and-in-combination-with-rifampin-and-tigecycline-against-gram-positive-cocci-isolated-from-surgical-wound-infections
#3
Oriana Simonetti, Gianluca Morroni, Roberto Ghiselli, Fiorenza Orlando, Andrea Brenciani, Ledia Xhuvelaj, Mauro Provinciali, Annamaria Offidani, Mario Guerrieri, Andrea Giacometti, Oscar Cirioni
Complicated skin and soft tissue infections constitute a heterogeneous group of severe disorders, with surgical site infections being the most common hospital-acquired ones. The aim of our study was to investigate the synergistic and bactericidal activities of antimicrobial combinations of fosfomycin with rifampicin and tigecycline against Enterococcus faecalis, Enterococcus faecium and methicillin-resistant Staphylococcus aureus (MRSA) clinical isolates, and also to evaluate their in vivo effects in a mouse wound infection model...
November 20, 2017: Journal of Medical Microbiology
https://www.readbyqxmd.com/read/29153513/biofilm-formation-of-staphylococcus-aureus-dairy-isolates-representing-different-genotypes
#4
E Thiran, P A Di Ciccio, H U Graber, E Zanardi, A Ianieri, J Hummerjohann
The objective of this study was to compare the biofilm-forming capabilities of different genotypes of Staphylococcus aureus dairy isolates from Switzerland and northern Italy, including Staph. aureus genotype B (GTB) and methicillin-resistant Staph. aureus (MRSA). We hypothesized that biofilm formation might be more pronounced in the contagious GTB isolates compared with other genotypes affecting individual animals. Twenty-four dairy isolates, including 9 MRSA, were further characterized by genotyping by using ribosomal spacer PCR, spa typing, biofilm formation under static and dynamic conditions, and scanning electron microscopy...
November 15, 2017: Journal of Dairy Science
https://www.readbyqxmd.com/read/29153470/impact-of-a-pharmacist-driven-care-package-on-staphylococcus-aureus-bacteremia-management-in-a-large-community-healthcare-network-a-propensity-score-matched-quasi-experimental-study
#5
Jordan R Smith, Jeremy J Frens, Cynthia B Snider, Kimberly C Claeys
OBJECTIVES: Staphylococcus aureus bacteremia (SAB) is an important cause of morbidity and mortality. Suboptimal treatment has been associated with poor patient outcomes. Our antimicrobial stewardship program (ASP) evaluated SAB management based on predefined performance measures both prior to and after instituting a "care package" intervention led by clinical pharmacists and infectious diseases physicians. The primary outcome included a 4-point "optimal care score" (OCS) consisting of targeted antibiotic therapy within 24hours, repeating blood cultures, antibiotic duration assessment, and appropriate duration of therapy...
October 7, 2017: Diagnostic Microbiology and Infectious Disease
https://www.readbyqxmd.com/read/29152580/chromosomal-targeting-by-the-type-iii-a-crispr-cas-system-can-reshape-genomes-in-staphylococcus-aureus
#6
Jing Guan, Wanying Wang, Baolin Sun
CRISPR-Cas (clustered regularly interspaced short palindromic repeat [CRISPR]-CRISPR-associated protein [Cas]) systems can provide protection against invading genetic elements by using CRISPR RNAs (crRNAs) as a guide to locate and degrade the target DNA. CRISPR-Cas systems have been classified into two classes and five types according to the content of cas genes. Previous studies have indicated that CRISPR-Cas systems can avoid viral infection and block plasmid transfer. Here we show that chromosomal targeting by the Staphylococcus aureus type III-A CRISPR-Cas system can drive large-scale genome deletion and alteration within integrated staphylococcal cassette chromosome mec (SCCmec)...
November 2017: MSphere
https://www.readbyqxmd.com/read/29151993/antibiotic-based-phenotype-and-hospital-admission-profile-are-the-most-likely-predictors-of-genotyping-classification-of-mrsa
#7
Ali M Bazzi, Jaffar A Al-Tawfiq, Ali A Rabaan, Dianne Neal, Aimee Ferraro, Mahmoud M Fawarah
Background: Methicillin-resistant Staphylococcus aureus (MRSA) infection is associated with increased morbidity, mortality, and financial burdens. Phenotyping methods are used to classify MRSA as either health care MRSA (HA-MRSA) or community-associated MRSA (CA-MRSA). Recent studies suggested the phenotyping methods are not always reliable, based on a lack of concordance with genotyping results. Objective: In this study, concordance of classification methods based on clinical characteristics or antibiotic susceptibility compared to the gold standard genotyping was assessed in the classification of MRSA...
2017: Open Microbiology Journal
https://www.readbyqxmd.com/read/29151652/antimicrobial-efficacy-of-synthetic-pyranochromenones-and-coumarinyloxy-acetamides
#8
Abhishek K Singh, Suchita Prasad, Bipul Kumar, Shiv Kumar, Amitesh Anand, Shashank S Kamble, Sunil K Sharma, Hemant K Gautam
Four (1, 2, 4 and 6) synthetic quaternary ammonium derivatives of pyranochromenones and (coumarinyloxy)acetamides were synthesized and investigated for their antimicrobial efficacy on MRSA (Methicillin-resistant Staphylococcus aureus), and multi-drug resistant Pseudomonas aeruginosa, Salmonella enteritidis and Mycobacterium tuberculosis H37Rv strain. One of the four compounds screened i.e. N,N,N-triethyl-10-((4,8,8-trimethyl-2-oxo-2,6,7,8-tetrahydropyrano[3,2-g]chromen-10-yl)oxy)decan-1-aminium bromide (1), demonstrated significant activity against S...
December 2017: Indian Journal of Microbiology
https://www.readbyqxmd.com/read/29151647/7-10-epoxyoctadeca-7-9-dienoic-acid-a-small-molecule-adjuvant-that-potentiates-%C3%AE-lactam-antibiotics-against-multidrug-resistant-staphylococcus-aureus
#9
Chakradhar Dasagrandhi, Young-Soon Kim, In-Hwan Kim, Ching T Hou, Hak-Ryul Kim
The emergence of methicillin-resistant Staphylococcus aureus (MRSA) infections with multi-drug resistance needs effective and alternative control strategies. In this study we investigated the adjuvant effect of a novel furan fatty acid, 7,10-epoxyoctadeca-7,9-dienoic acid (7,10-EODA) against multidrug-resistant S. aureus (MDRSA) strain 01ST001 by disc diffusion, checker board and time kill assays. Further the membrane targeting action of 7,10-EODA was investigated by spectroscopic and confocal microscopic studies...
December 2017: Indian Journal of Microbiology
https://www.readbyqxmd.com/read/29151645/management-of-staphylococcus-mediated-systemic-infection-by-enhancing-the-resurging-activity-of-co-trimoxazole-in-presence-of-cryptdin-2
#10
Amrita Kaur, Shiv Kumar Chabba, Ujjwal Jit Kaur, Arashdeep Kaur, Simran Preet, Praveen Rishi
Resurgence of sensitivity of the antibiotics, to which the pathogen had developed resistance in the past, requires special attention for strengthening the reservoir of antimicrobial compounds. Reports in the recent past have suggested that co-trimoxazole (COT) has regained its activity against methicillin resistant Staphylococcus aureus (MRSA). The present study exploited the use of COT in the presence of an antimicrobial peptide (AMP), cryptdin-2 (a murine Paneth cell alpha defensin), in order to reduce the selective pressure of the antibiotic on the pathogen...
December 2017: Indian Journal of Microbiology
https://www.readbyqxmd.com/read/29150889/novel-aqueous-oil-in-water-emulsions-containing-extracts-of-natural-coniferous-resins-are-strongly-antimicrobial-against-enterobacteria-staphylococci-and-yeasts-as-well-as-on-bacterial-biofilms
#11
Elias Haapakorva, Thomas Holmbom, Atte von Wright
AIMS: The aim of this study was to examine the antimicrobial properties of novel aqueous natural rapeseed oil/saline emulsions containing different soluble components of spruce resin. METHODS AND RESULTS: The composition of aqueous resin emulsions was analyzed by GC-MS and their antimicrobial properties were studied with challenge tests and with turbidometric assays. The emulsions were strongly antimicrobial against common Gram-positive and Gram-negative bacteria (including MRSA) as well as common yeasts...
November 18, 2017: Journal of Applied Microbiology
https://www.readbyqxmd.com/read/29149185/linezolid-and-atorvastatin-impact-on-pneumonia-caused-by-staphyloccocus-aureus-in-rabbits-with-or-without-mechanical-ventilation
#12
Laure-Anne Pauchard, Mathieu Blot, Rémi Bruyere, Saber-Davide Barbar, Delphine Croisier, Lionel Piroth, Pierre-Emmanuel Charles
Pneumonia may involve methicillin-resistant Staphylococcus aureus (MRSA), with elevated rates of antibiotics failure. The present study aimed to assess the effect of statins given prior to pneumonia development. Spontaneously breathing (SB) or mechanically ventilated (MV) rabbits with pneumonia received atorvastatin alone, linezolid (LNZ) alone, or a combination of both (n = 5 in each group). Spontaneously breathing and MV untreated infected animals (n = 11 in each group), as well as uninfected animals (n = 5 in each group) were used as controls...
2017: PloS One
https://www.readbyqxmd.com/read/29147471/experience-with-ceftaroline-for-treatment-of-methicillin-resistant-staphylococcus-aureus-pneumonia-in-a-community-hospital
#13
Apurwa Karki, Craig Thurm, Kelly Cervellione
Background: Methicillin-resistant Staphylococcus aureus (MRSA) is an organism causing significant mortality and morbidity with nosocomial infections. Ceftaroline is a new cephalosporin antibiotic that has activity against MRSA. In the USA, this antibiotic has not been approved for use in pneumonia caused by MRSA. Objectives: To review the use of ceftaroline in MRSA pneumonia in a US hospital and evaluate its clinical success. Methods: A retrospective study was conducted in an urban community hospital assessing the use of ceftaroline for MRSA pneumonia...
2017: Journal of Community Hospital Internal Medicine Perspectives
https://www.readbyqxmd.com/read/29146499/antimicrobial-resistance-and-virulence-genes-profiling-of-methicillin-resistant-staphylococcus-aureus-isolates-in-a-burn-center-a-5-year-study
#14
Bei Jiang, Supeng Yin, Bo You, Yali Gong, Guangtao Huang, Zichen Yang, Yulong Zhang, Yu Chen, Jing Chen, Zhiqiang Yuan, Xiaomei Hu, Yizhi Peng
Methicillin-resistant S. aureus (MRSA) has attracted more and more attention in recent years, especially in burn medical centers. Here we conducted a 5-year period study to evaluate the MRSA infection in our burn center. The staphylococcal chromosomal cassette mec (SCCmec) typing, antimicrobials susceptibility and virulence profiles were also performed among the MRSA isolates. Of the 259 S. aureus isolates, 239 (92.28%) isolates were identified as MRSA. A decreased trend of MRSA isolation rate over time was found (P = 0...
November 13, 2017: Microbial Pathogenesis
https://www.readbyqxmd.com/read/29146256/isolation-purification-structural-elucidation-and-antimicrobial-activities-of-kocumarin-a-novel-antibiotic-isolated-from-actinobacterium-kocuria-marina-cmg-s2-associated-with-the-brown-seaweed-pelvetia-canaliculata
#15
Bushra Uzair, Farid Menaa, Barkat Ali Khan, Faryal Vali Mohammad, Viqar Uddin Ahmad, Ryad Djeribi, Bouzid Menaa
AIMS: Screening of seaweed-associated bacteria capable of producing antimicrobials. METHODS AND RESULTS: Fifteen microbial strains, associated to the brown seaweed Pelvetia canaliculata (Linnaeus) attached to the rocks of Sonmiani Beach (Karachi, Pakistan), were screened. Crude extract filtrates of CMG S2 strain grew on Zobell marine agar (ZMA) had the most remarkable antimicrobial activity. Based on its phenotypic aspects (e.g. Gram-positive, microccoid form), biochemical characteristics (e...
January 2018: Microbiological Research
https://www.readbyqxmd.com/read/29145465/hospital-associated-methicillin-resistant-staphylococcus-aureus-a-cross-sectional-analysis-of-risk-factors-in-south-african-tertiary-public-hospitals
#16
Liliwe L Shuping, Lazarus Kuonza, Alfred Musekiwa, Samantha Iyaloo, Olga Perovic
INTRODUCTION: Hospital-associated methicillin-resistant S. aureus (HA-MRSA) remains a significant cause of morbidity and mortality worldwide. We conducted a study to determine risk factors for HA-MRSA in order to inform control strategies in South Africa. METHODS: We used surveillance data collected from five tertiary hospitals in Gauteng and Western Cape provinces during 2014 for analysis. A case of HA-MRSA was defined as isolation of MRSA from a blood culture 48 hours after admission and/or if the patient was hospitalised in the six months prior to the current culture...
2017: PloS One
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#17
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29144223/no-touch-disinfection-methods-to-decrease-multidrug-resistant-organism-infections-a-systematic-review-and-meta-analysis
#18
Alexandre R Marra, Marin L Schweizer, Michael B Edmond
BACKGROUND Recent studies have shown that using no-touch disinfection technologies (ie, ultraviolet light [UVL] or hydrogen peroxide vapor [HPV] systems) can limit the transmission of nosocomial pathogens and prevent healthcare-associated infections (HAIs). To investigate these findings further, we performed a systematic literature review and meta-analysis on the impact of no-touch disinfection methods to decrease HAIs. METHODS We searched PubMed, CINAHL, CDSR, DARE and EMBASE through April 2017 for studies evaluating no-touch disinfection technology and the nosocomial infection rates for Clostridium difficile, methicillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant enterococci (VRE), and other multidrug-resistant organisms (MDROs)...
November 16, 2017: Infection Control and Hospital Epidemiology
https://www.readbyqxmd.com/read/29142545/rapid-screening-of-pyogenic-staphylococcus-aureus-for-confirmation-of-genus-and-species-methicillin-resistance-and-virulence-factors-by-using-two-novel-multiplex-pcr
#19
Abdul Haque, Asma Haque, Muhammad Saeed, Aysha Azhar, Samreen Rasool, Sidra Shan, Beenish Ehsan, Zohaib Nisar
Objectives: Emergence of methicillin resistant Staphylococcus aureus (MRSA) is a major medical problem of current era. These bacteria are resistant to most drugs and rapid diagnosis can provide a clear guideline to clinicians. They possess specific virulence factors and relevant information can be very useful. We designed this study to develop multiplex PCRs to provide rapid information. Methods: We studied 60 Staphylococcus aureus isolates and detected methicillin resistance by cefoxitin sensitivity and targeting of mecA gene...
September 2017: Pakistan Journal of Medical Sciences Quarterly
https://www.readbyqxmd.com/read/29138963/synthesis-of-novel-tetrazole-containing-hybrid-ciprofloxacin-and-pipemidic-acid-analogues-and-preliminary-biological-evaluation-of-their-antibacterial-and-antiproliferative-activity
#20
Kommula Dileep, Sowjanya Polepalli, Nishant Jain, Sudheer Kumar Buddana, R S Prakasham, M S R Murty
A series of 1-substituted-1H-tetrazole-5-thiol building blocks were synthesized and introduced to the N-4 piperazinyl group at C-7 position of the quinolone core, and these novel compounds (5a-g and 8a-g) were screened for their antibacterial and antiproliferative activities. Bioactive assay studies manifested that most of new compounds exhibited significant antibacterial activity against the tested strains, including multi-drug-resistant MRSA in comparison with reference drugs ciprofloxacin, streptomycin B and pipemidic acid...
November 14, 2017: Molecular Diversity
keyword
keyword
22006
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"