keyword
MENU ▼
Read by QxMD icon Read
search

Ll-37

keyword
https://www.readbyqxmd.com/read/29337066/listeria-monocytogenes-endocarditis-case-report-review-of-the-literature-and-laboratory-evaluation-of-potential-novel-antibiotic-synergies
#1
Monika Kumaraswamy, Carter Do, George Sakoulas, Poochit Nonejuie, Guan Woei Tseng, Helen King, Joshua Fierer, Joe Pogliano, Victor Nizet
Endocarditis is a rare but serious manifestation of Listeria monocytogenes (LM). However, the optimal treatment strategy for LM endocarditis has yet to be established. Current antibiotic strategies for listeriosis include penicillin G or ampicillin (AMP) monotherapy, or AMP + gentamicin combination therapy which is often favored for endocarditis. The primary objective of our investigation was to assess the utility of AMP + ceftriaxone (CRO) and AMP + daptomycin (DAP) against LM, modeling less nephrotoxic antibiotic combinations traditionally used to manage resistant enterococcal endocarditis...
January 11, 2018: International Journal of Antimicrobial Agents
https://www.readbyqxmd.com/read/29321257/the-antimicrobial-peptide-saap-148-combats-drug-resistant-bacteria-and-biofilms
#2
Anna de Breij, Martijn Riool, Robert A Cordfunke, Nermina Malanovic, Leonie de Boer, Roman I Koning, Elisabeth Ravensbergen, Marnix Franken, Tobias van der Heijde, Bouke K Boekema, Paulus H S Kwakman, Niels Kamp, Abdelouahab El Ghalbzouri, Karl Lohner, Sebastian A J Zaat, Jan W Drijfhout, Peter H Nibbering
Development of novel antimicrobial agents is a top priority in the fight against multidrug-resistant (MDR) and persistent bacteria. We developed a panel of synthetic antimicrobial and antibiofilm peptides (SAAPs) with enhanced antimicrobial activities compared to the parent peptide, human antimicrobial peptide LL-37. Our lead peptide SAAP-148 was more efficient in killing bacteria under physiological conditions in vitro than many known preclinical- and clinical-phase antimicrobial peptides. SAAP-148 killed MDR pathogens without inducing resistance, prevented biofilm formation, and eliminated established biofilms and persister cells...
January 10, 2018: Science Translational Medicine
https://www.readbyqxmd.com/read/29310594/the-impact-of-cathelicidin-the-human-antimicrobial-peptide-ll-37-in-urinary-tract-infections
#3
Ibrahim H Babikir, Elsir A Abugroun, Naser Eldin Bilal, Abdullah Ali Alghasham, Elmuataz Elmansi Abdalla, Ishag Adam
BACKGROUND: The defense mechanisms of the urinary tract are attributed mainly to the innate immune system and the urinary tract urothelium which represent the first line of defense against invading pathogens and maintaining sterility of the urinary tract. There are only a few publications regarding cathelicidin (LL-37) and a urinary tract infection (UTI). This study was done to investigate the plasma and urine levels of human LL-37 in patients with UTI. METHODS: A case-control study was conducted at Omdurman Hospital, Sudan during the period from August 2014 to May 2017...
January 8, 2018: BMC Infectious Diseases
https://www.readbyqxmd.com/read/29307075/counter-ion-effect-on-antistaphylococcal-activity-and-cytotoxicity-of-selected-antimicrobial-peptides
#4
Karol Sikora, Maciej Jaśkiewicz, Damian Neubauer, Marta Bauer, Sylwia Bartoszewska, Wioletta Barańska-Rybak, Wojciech Kamysz
In view of an appreciable increase in resistance of Staphylococcus aureus to the conventional antibiotics, it is desired to develop new effective drugs. Antimicrobial peptides (AMPs) seem to be attractive candidates. In general, AMPs samples used for in vitro studies consist of a peptide, counter-ion, and water. The presence of the counter-ion could be significant as it affects peptide secondary structure and biological activity. The purpose of this study was to estimate the impact of counter-ion on antistaphylococcal activity of selected AMPs (CAMEL, citropin 1...
January 6, 2018: Amino Acids
https://www.readbyqxmd.com/read/29277539/skin-wound-healing-is-accelerated-by-a-lipid-mixture-representing-major-lipid-components-of-chamaecyparis-obtusa-plant-extract
#5
Byung Eui Kim, Elena Goleva, Clifton F Hall, Sang Hyun Park, Un Ha Lee, Anne M Brauweiler, Joanne E Streib, Brittany N Richers, Gwuicheol Kim, Donald Y M Leung
In chronic non-healing wounds, the healing process is disrupted and wounds are often infected with bacteria. About 85% of lower extremity amputations in diabetes are attributed to deep infection of foot ulcers. Therefore, infection control is critical for wound care. In this study, we analyzed lipid composition of Chamaecyparis (C) obtusa extract, and describe the wound healing properties of its combination of ten major lipid components. A 10 lipid mixture upregulated HBD-3 and LL-37 through the olfactory receptor 2AT4, and induced phosphorylation of extracellular signal-regulated kinases and p38 mitogen-activated protein kinases in primary human keratinocytes...
December 22, 2017: Journal of Investigative Dermatology
https://www.readbyqxmd.com/read/29273721/topographical-diversity-of-common-skin-microflora-and-its-association-with-skin-environment-type-an-observational-study-in-chinese-women
#6
Xi Li, Chao Yuan, Licong Xing, Philippe Humbert
This study evaluated cutaneous microbial distribution, and microbial co-occurrence at different body sites and skin environments in Chinese women (39.6 ± 11.9 years, N = 100) during the winter season. Microbial distribution (Propionibacterium acnes, Staphylococcus aureus, Staphylococcus epidermidis, Lactobacillus, Pseudomonadaceae, and Malassezia furfur), association with biomarkers (antimicrobial peptides: LL-37, β-defensins [HBD-2, HBD-3]), and claudin-1) and skin biophysical parameters (transepidermal water loss, pH, skin scaliness and roughness, sebum and hydration levels) were also determined...
December 22, 2017: Scientific Reports
https://www.readbyqxmd.com/read/29242830/interaction-of-antibiotics-with-innate-host-defense-factors-against-salmonella-enterica-serotype-newport
#7
George Sakoulas, Monika Kumaraswamy, Armin Kousha, Victor Nizet
This study examines the pharmacodynamics of antimicrobials that are used to treat Salmonella with each other and with key components of the innate immune system. Antimicrobial synergy was assessed using time-kill and checkerboard assays. Antimicrobial interactions with innate immunity were studied by employing cathelicidin LL-37, whole-blood, and neutrophil killing assays. Ceftriaxone and ciprofloxacin were found to be synergistic in vitro against Salmonella enterica serotype Newport. Ceftriaxone, ciprofloxacin, and azithromycin each demonstrated synergy with the human cathelicidin defense peptide LL-37 in killing Salmonella...
November 2017: MSphere
https://www.readbyqxmd.com/read/29239826/circulating-cathelicidin-ll-37-level-is-increased-in-euthymic-patients-with-bipolar-disorder
#8
Elżbieta Kozłowska, Paulina Żelechowska, Ewa Brzezińska-Błaszczyk, Aleksandra Margulska, Adam Wysokiński
More and more data seems to imply that immune mechanisms are involved in the pathomechanism of bipolar disorder (BD). However, the primary role of cathelicidin LL-37 is defense against pathogens, more and more data indicated that this peptide strongly modulates immune system functioning and contributes to immune pathology of chronic and inflammatory diseases. No data is available on the level of LL-37 in bipolar patients. The aim of the study was to examine the circulating levels of cathelicidin LL-37 in euthymic patients with BD...
November 24, 2017: Journal of Clinical Neuroscience: Official Journal of the Neurosurgical Society of Australasia
https://www.readbyqxmd.com/read/29226422/pathogenesis-of-psoriasis-and-development-of-treatment
#9
REVIEW
Eisaku Ogawa, Yuki Sato, Akane Minagawa, Ryuhei Okuyama
The pathogenesis of psoriasis can be explained by dysregulation of immunological cell function as well as keratinocyte proliferation/differentiation. Recently, the immunological pathomechanism has been clarified substantially. Whereas T-helper (Th)1 overactivation was thought to induce occurrence of psoriasis, it has been demonstrated that Th17 cells play a key role. Th17 development is maintained by interleukin (IL)-23 mainly produced by dendritic cells. Th17 cells produce various cytokines, including IL-17A, IL-17F and IL-22...
December 10, 2017: Journal of Dermatology
https://www.readbyqxmd.com/read/29222824/elevated-levels-of-the-antimicrobial-peptide-ll-37-in-hidradenitis-suppurativa-are-associated-with-a-th1-th17-immune-response
#10
R Thomi, C Schlapbach, N Yawalkar, D Simon, D Yerly, R E Hunger
Hidradenitis suppurativa (HS) is an inflammatory skin disease with poorly understood immunopathogenic mechanisms. LL-37 is an antimicrobial peptide, which is transcribed from the CAMP (cathelicidin antimicrobial peptide) gene. Previous reports showed upregulated levels of CAMP and LL-37 in HS lesions and therefore the aim of this study was to compare levels of LL-37 in HS to other inflammatory skin diseases and to establish immunomodulatory functions of LL-37 in HS. We confirm an upregulation of the LL-37 peptide in lesional HS skin with comparable levels as in psoriasis patients and are able to positively correlate the presence of LL-37 in HS with the presence of T cells, macrophages, neutrophils, IFNγ, IL-17, IL-23, TNFα, IL-32 and IL-1β...
December 8, 2017: Experimental Dermatology
https://www.readbyqxmd.com/read/29211886/bicarbonate-induces-high-level-resistance-to-the-human-antimicrobial-peptide-ll-37-in-staphylococcus-aureus-small-colony-variants
#11
Ping Zhang, John A Wright, Anna Tymon, Sean P Nair
Objectives: Staphylococcus aureus small colony variants (SCVs) cause persistent infections and are resistant to cationic antibiotics. Antimicrobial peptides (AMPs) have been suggested as promising alternatives for treating antibiotic-resistant bacteria. We investigated the capacity of the human cationic AMP LL-37 to kill SCVs in the presence of physiological concentrations of bicarbonate, which are reported to alter bacterial membrane permeability and change resistance of bacteria to AMPs...
December 4, 2017: Journal of Antimicrobial Chemotherapy
https://www.readbyqxmd.com/read/29208979/induction-of-antimicrobial-peptides-secretion-by-il-1%C3%AE-enhances-human%C3%A2-amniotic-membrane-for-regenerative-medicine
#12
Fatemeh A Tehrani, Khashayar Modaresifar, Sara Azizian, Hassan Niknejad
Due to antibacterial characteristic, amnion has been frequently used in different clinical situations. Developing an in vitro method to augment endogenous antibacterial ingredient of amniotic epithelial and mesenchymal stem cells is desirable for a higher efficacy of this promising biomaterial. In this study, epithelial or mesenchymal side dependent effect of amniotic membrane (AM) on antibacterial activity against some laboratory and clinical isolated strains was investigated by modified disk diffusion method and colony count assay...
December 5, 2017: Scientific Reports
https://www.readbyqxmd.com/read/29208061/antichagasic-effect-of-crotalicidin-a-cathelicidin-like-vipericidin-found-in-crotalus-durissus-terrificus-rattlesnake-s-venom-gland
#13
Izabel Cristina Justino Bandeira, Danya Bandeira-Lima, Clarissa Perdigão Mello, Ticiana Praciano Pereira, Ramon Róseo Paula Pessoa Bezerra De Menezes, Tiago Lima Sampaio, Cláudio Borges Falcão, Gandhi Rádis-Baptista, Alice Maria Costa Martins
Cathelicidins are antimicrobial peptides produced by humans and animals in response to various pathogenic microbes. Crotalicidin (Ctn), a cathelicidin-related vipericidin from the South American Crotalus durissus terrificus rattlesnake's venom gland, and its fragments have demonstrated antimicrobial and antifungal activity, similarly to human cathelicidin LL-37. In order to provide templates for the development of modern trypanocidal agents, the present study evaluated the antichagasic effect of these four peptides (Ctn, Ctn[1-14], Ctn[15-34] and LL-37)...
December 6, 2017: Parasitology
https://www.readbyqxmd.com/read/29206168/significance-and-diagnostic-role-of-antimicrobial-cathelicidins-ll-37-peptides-in-oral-health
#14
REVIEW
Zohaib Khurshid, Mustafa Naseem, Faris Yahya I Asiri, Maria Mali, Rabia Sannam Khan, Haafsa Arshad Sahibzada, Muhammad Sohail Zafar, Syed Faraz Moin, Erum Khan
Cathelicidins are a group of oral antimicrobial peptides that play multiple vital roles in the human body, such as their antimicrobial (broad spectrum) role against oral microbes, wound healing, and angiogenesis, with recent evidences about their role in cancer regulation. Cathelicidins are present in humans and other mammals as well. By complex interactions with the microenvironment, it results in pro-inflammatory effects. Many in vitro and in vivo experiments have been conducted to ultimately conclude that these unique peptides play an essential role in innate immunity...
December 5, 2017: Biomolecules
https://www.readbyqxmd.com/read/29191501/immunoprecipitation-high-performance-liquid-chromatographic-analysis-of-healing-process-in-chronic-suppurative-osteomyelitis-of-the-jaw
#15
Soung Min Kim, Mi Young Eo, Yun Ju Cho, Yeon Sook Kim, Suk Keun Lee
PURPOSE: Chronic suppurative osteomyelitis (CSO) of the jaw is one of the most difficult infectious diseases to manage, because it causes progressive bony destruction and is associated with bacterial inhabitation of the sequestra. A combination of antibiotic therapy and surgical debridement is often used to treat CSO. Nevertheless, various systemic conditions can lead to life-threatening complications. METHODS: The present study aimed to explore the wound healing progress in 16 cases of CSO through protein expression analysis of postoperative exudates (POE) that were collected 6 h, 1 day, and 2 days after saucerization and/or decortication...
October 27, 2017: Journal of Cranio-maxillo-facial Surgery
https://www.readbyqxmd.com/read/29164103/the-human-antimicrobial-peptides-dermcidin-and-ll-37-show-novel-distinct-pathways-in-membrane-interactions
#16
REVIEW
Kornelius Zeth, Enea Sancho-Vaello
Mammals protect themselves from inflammation triggered by microorganisms through secretion of antimicrobial peptides (AMPs). One mechanism by which AMPs kill bacterial cells is perforating their membranes. Membrane interactions and pore formation were investigated for α-helical AMPs leading to the formulation of three basic mechanistic models: the barrel stave, toroidal, and carpet model. One major drawback of these models is their simplicity. They do not reflect the real in vitro and in vivo conditions. To challenge and refine these models using a structure-based approach we set out to investigate how human cathelicidin (LL-37) and dermcidin (DCD) interact with membranes...
2017: Frontiers in Chemistry
https://www.readbyqxmd.com/read/29163395/role-of-soluble-innate-effector-molecules-in-pulmonary-defense-against-fungal-pathogens
#17
REVIEW
Soledad R Ordonez, Edwin J A Veldhuizen, Martin van Eijk, Henk P Haagsman
Fungal infections of the lung are life-threatening but rarely occur in healthy, immunocompetent individuals, indicating efficient clearance by pulmonary defense mechanisms. Upon inhalation, fungi will first encounter the airway surface liquid which contains several soluble effector molecules that form the first barrier of defense against fungal infections. These include host defense peptides, like LL-37 and defensins that can neutralize fungi by direct killing of the pathogen, and collectins, such as surfactant protein A and D, that can aggregate fungi and stimulate phagocytosis...
2017: Frontiers in Microbiology
https://www.readbyqxmd.com/read/29160535/an-investigation-of-human-beta-defensins-and-cathelicidin-expression-in-patients-with-pterygium
#18
Remzi Karadag, Nurettin Bayram, Serpil Oguztuzun, Huseyin Bayramlar, Busra Bozer, Gulcin Simsek, Christopher J Rapuano
PURPOSE: To investigate human beta-defensins (HBDs) and cathelicidin LL-37 (LL-37) expressions in patients with pterygium. METHODS: In this retrospective consecutive case series, 26 pterygium specimens and 15 normal conjunctival specimens of 15 control subjects were in vestigated. Expressions of HBD-1, HBD-2, HBD-3, and LL-37 were assessed using immuno histochemical staining. A brown color in the cytoplasm and/or nuclei of epithelial cells indicated positive staining for HBDs and LL-37...
September 2017: Arquivos Brasileiros de Oftalmologia
https://www.readbyqxmd.com/read/29157732/rnase-7-strongly-promotes-tlr9-mediated-dna-sensing-by-human-plasmacytoid-dendritic-cells
#19
V Kopfnagel, S Wagenknecht, J Harder, K Hofmann, M Kleine, A Buch, B Sodeik, T Werfel
Plasmacytoid dendritic cells (pDCs) were described to accumulate in the skin of patients with psoriasis and to be recruited into the dermis upon allergen challenge in atopic dermatitis. Importantly, activation of pDCs in the skin has been identified as important initiator of psoriasis development. RNase 7 is one of the major antimicrobial peptides (AMP) secreted by keratinocytes and is expressed in significantly higher amounts in lesional skin of patients with atopic dermatitis or psoriasis than in healthy individuals...
November 17, 2017: Journal of Investigative Dermatology
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#20
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
keyword
keyword
21260
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"