keyword
MENU ▼
Read by QxMD icon Read
search

promoter dynamics

keyword
https://www.readbyqxmd.com/read/29150590/subtype-specific-effects-of-dopaminergic-d2-receptor-activation-on-synaptic-trains-in-layer-v-pyramidal-neurons-in-the-mouse-prefrontal-cortex
#1
Jonna M Leyrer-Jackson, Mark P Thomas
In humans, prefrontal cortical areas are known to support executive functions. In mice, these functions are mediated by homologous regions in the medial prefrontal cortex (mPFC). Executive processes are critically dependent on optimal levels of dopamine (DA), but the cellular mechanisms of DA modulation are incompletely understood. Stable patterns of neuronal activity may be sensitive to frequency-dependent changes in synaptic transmission. We characterized the effects of D2 receptor (D2R) activation on short-term excitatory postsynaptic potential (EPSP) dynamics evoked at varying frequencies in the two subtypes of layer V pyramidal neurons in mouse mPFC We isolated NMDA receptor and non-NMDA receptor-mediated components of EPSP trains evoked by stimulating fibers within layer V or layer I...
November 2017: Physiological Reports
https://www.readbyqxmd.com/read/29150516/drna-seq-implicates-sulfide-as-master-regulator-of-s-0-metabolism-in-chlorobaculum-tepidum-and-other-green-sulfur-bacteria
#2
Jacob M Hilzinger, Vidhyavathi Raman, Kevin E Shuman, Brian J Eddie, Thomas E Hanson
The green sulfur bacteria (Chlorobiaceae) are anaerobes that use electrons from reduced sulfur compounds (sulfide, S(0), and thiosulfate) as electron donors for photoautotrophic growth. Chlorobaculum tepidum, the model system for the Chlorobiaceae, both produces and consumes extracellular S(0) globules depending on the availability of sulfide in the environment. These physiological changes imply significant changes in gene regulation, which has been observed when sulfide is added to Cba. tepidum growing on thiosulfate...
November 17, 2017: Applied and Environmental Microbiology
https://www.readbyqxmd.com/read/29150015/the-flotation-and-adsorption-of-mixed-collectors-on-oxide-and-silicate-minerals
#3
REVIEW
Longhua Xu, Jia Tian, Houqin Wu, Zhongyuan Lu, Wei Sun, Yuehua Hu
The analysis of flotation and adsorption of mixed collectors on oxide and silicate minerals is of great importance for both industrial applications and theoretical research. Over the past years, significant progress has been achieved in understanding the adsorption of single collectors in micelles as well as at interfaces. By contrast, the self-assembly of mixed collectors at liquid/air and solid/liquid interfaces remains a developing area as a result of the complexity of the mixed systems involved and the limited availability of suitable analytical techniques...
November 11, 2017: Advances in Colloid and Interface Science
https://www.readbyqxmd.com/read/29149479/cripsr-cas-expands-dynamic-range-of-gene-expression-from-t7rnap-promoters
#4
Sean R McCutcheon, Kwan Lun Chiu, Daniel D Lewis, Cheemeng Tan
BACKGROUND: Reducing leaky gene expression is critical for improving protein yield of recombinant bacteria and stability of engineered cellular circuits in synthetic biology. Leaky gene expression occurs when a genetic promoter is not fully repressed, leading to unintended protein synthesis in the absence of stimuli. Existing work has devised specific molecular strategies for reducing leaky gene expression of each promoter. Main Method and Results: In contrast, we describe a repurposed, modular CRISPRi system that attenuates leaky gene expression using a series of single-guide RNAs targeting the PT7/LacO1 ...
November 17, 2017: Biotechnology Journal
https://www.readbyqxmd.com/read/29148803/hsdhodh-microdomain-membrane-interactions-are-influenced-by-the-lipid-composition
#5
Eduardo Festozo Vicente, Indra Dev Sahu, Edson Crusca, Luis Guilherme Mansor Basso, Claudia Elisabeth Munte, Antonio Jose Costa-Filho, Gary A Lorigan, Eduardo Maffud Maffud Cilli
Human dihydroorotate dehydrogenase (HsDHODH) enzyme has been studied as selective target for inhibitors to block the enzyme activity, intending to prevent proliferative diseases. The N-terminal microdomain seems to play an important role in the enzyme function. However, the molecular mechanism of action and dynamics of this region are not totally understood yet. This study analyzes the interaction and conformation in model membranes of HsDHODH microdomain using peptide analogues containing the paramagnetic amino acid TOAC at strategic positions...
November 17, 2017: Journal of Physical Chemistry. B
https://www.readbyqxmd.com/read/29148557/structural-and-thermodynamical-properties-of-early-human-amylin-oligomers-using-replica-exchange-molecular-dynamics-mutation-effect-of-three-key-residues-f15-h18-and-f23
#6
S Bouzakraoui, N Mousseau
Human islet amyloid polypeptide (hIAPP) is a 37-residue polypeptide, considered to be the main component of the pancreatic islet amyloid associated with type 2 diabetes and is one of the most amyloidogenic polypeptides known. Although the structure of hIAPP fibrils has already been obtained, structures of early oligomers and the mechanism of β-sheet formation remain poorly understood. Herein, we characterize the atomic structure and the thermodynamics of the 14-37 residue fragment of hIAPP wild-type and mutated dimers and trimers...
November 17, 2017: Physical Chemistry Chemical Physics: PCCP
https://www.readbyqxmd.com/read/29147993/preparation-and-characterization-of-gelatin-sericin-carboxymethyl-chitosan-medical-tissue-glue
#7
Min Liang, Zhenzhu Li, Cengceng Gao, Fuping Wang, Zhongmin Chen
BACKGROUND: The development and application of medical glue has been continuously expanding and advancing. However, there are few glues that combine low-cost with excellent biocompatibility. METHODS: We have prepared a medical tissue glue using a gelatin (Gel), sericin (SS) and carboxymethyl chitosan (CMCS) blend solution, cross-linked with 1-ethyl-3-(3-dimethylaminopropyl)-carbodiimide (EDC). The combination's characteristics and microstructure morphology were observed by Fourier transform infrared spectroscopy (FT-IR) and scanning electron microscope (SEM)...
November 16, 2017: Journal of Applied Biomaterials & Functional Materials
https://www.readbyqxmd.com/read/29146341/oxidation-and-nitrosation-of-meat-proteins-under-gastro-intestinal-conditions-consequences-in-terms-of-nutritional-and-health-values-of-meat
#8
Diane de La Pomélie, Véronique Santé-Lhoutellier, Thierry Sayd, Philippe Gatellier
The chemical changes (oxidation/nitrosation) of meat proteins during digestion lead to a decrease in their nutritional value. Moreover, oxidized and nitrosated amino acids are suspected to promote various human pathologies. To investigate the mechanisms and the kinetics of these endogenous protein modifications, we used a dynamic artificial digestive system (DIDGI®) that mimics the physicochemical conditions of digestion. The combined effect of meat cooking and endogenous addition of ascorbate and nitrite was evaluated on protein oxidation (by measuring carbonyl groups), protein nitrosation (by measuring nitrosamines), and proteolysis...
March 15, 2018: Food Chemistry
https://www.readbyqxmd.com/read/29146266/endophytism-or-saprophytism-decoding-the-lifestyle-transition-of-the-generalist-fungus-phomopsis-liquidambari
#9
Jun Zhou, Xin Li, Peng-Wei Huang, Chuan-Chao Dai
Filamentous ascomycete Phomopsis sp. are common inhabitants of natural ecosystems and, as saprophytes, are largely responsible for the destructive decay of litterfall, promoting the carbon and nitrogen cycles. Phomopsis liquidambari B3 can establish mutualistic symbiosis with a broad spectrum of crop plants. Colonizing dynamics observations and a growth promotion assay of rice and Arabidopsis thaliana revealed that the B3 colonization strategy is host-adapted and resulted in different growth promotions influenced by N availability...
January 2018: Microbiological Research
https://www.readbyqxmd.com/read/29146250/revitalization-of-plant-growth-promoting-rhizobacteria-for-sustainable-development-in-agriculture
#10
REVIEW
Sushanto Gouda, Rout George Kerry, Gitishree Das, Spiros Paramithiotis, Han-Seung Shin, Jayanta Kumar Patra
The progression of life in all forms is not only dependent on agricultural and food security but also on the soil characteristics. The dynamic nature of soil is a direct manifestation of soil microbes, bio-mineralization, and synergistic co-evolution with plants. With the increase in world's population the demand for agriculture yield has increased tremendously and thereby leading to large scale production of chemical fertilizers. Since the use of fertilizers and pesticides in the agricultural fields have caused degradation of soil quality and fertility, thus the expansion of agricultural land with fertile soil is near impossible, hence researchers and scientists have sifted their attention for a safer and productive means of agricultural practices...
January 2018: Microbiological Research
https://www.readbyqxmd.com/read/29146145/adars-and-editing-the-role-of-a-to-i-rna-modification-in-cancer-progression
#11
REVIEW
Kajsa Fritzell, Lidi Xu, Jens Lagergren, Marie Öhman
Cancer arises when pathways that control cell functions such as proliferation and migration are dysregulated to such an extent that cells start to divide uncontrollably and eventually spread throughout the body, ultimately endangering the survival of an affected individual. It is well established that somatic mutations are important in cancer initiation and progression as well as in creation of tumor diversity. Now also modifications of the transcriptome are emerging as a significant force during the transition from normal cell to malignant tumor...
November 13, 2017: Seminars in Cell & Developmental Biology
https://www.readbyqxmd.com/read/29145435/functional-characterisation-of-filamentous-actin-probe-expression-in-neuronal-cells
#12
Shrujna Patel, Sandra Y Y Fok, Holly Stefen, Tamara Tomanić, Esmeralda Parić, Rosanna Herold, Merryn Brettle, Aleksandra Djordjevic, Thomas Fath
Genetically encoded filamentous actin probes, Lifeact, Utrophin and F-tractin, are used as tools to label the actin cytoskeleton. Recent evidence in several different cell types indicates that these probes can cause changes in filamentous actin dynamics, altering cell morphology and function. Although these probes are commonly used to visualise actin dynamics in neurons, their effects on axonal and dendritic morphology has not been systematically characterised. In this study, we quantitatively analysed the effect of Lifeact, Utrophin and F-tractin on neuronal morphogenesis in primary hippocampal neurons...
2017: PloS One
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#13
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29143117/the-expression-of-ve-cadherin-in-breast-cancer-cells-modulates-cell-dynamics-as-a-function-of-tumor-differentiation-and-promotes-tumor-endothelial-cell-interactions
#14
Maryam Rezaei, Jiahui Cao, Katrin Friedrich, Björn Kemper, Oliver Brendel, Marianne Grosser, Manuela Adrian, Gustavo Baretton, Georg Breier, Hans-Joachim Schnittler
The cadherin switch has profound consequences on cancer invasion and metastasis. The endothelial-specific vascular endothelial cadherin (VE-cadherin) has been demonstrated in diverse cancer types including breast cancer and is supposed to modulate tumor progression and metastasis, but underlying mechanisms need to be better understood. First, we evaluated VE-cadherin expression by tissue microarray in 392 cases of breast cancer tumors and found a diverse expression and distribution of VE-cadherin. Experimental expression of fluorescence-tagged VE-cadherin (VE-EGFP) in undifferentiated, fibroblastoid and E-cadherin-negative MDA-231 (MDA-VE-EGFP) as well as in differentiated E-cadherin-positive MCF-7 human breast cancer cell lines (MCF-VE-EGFP), respectively, displayed differentiation-dependent functional differences...
November 15, 2017: Histochemistry and Cell Biology
https://www.readbyqxmd.com/read/29142759/forced-migrants-involved-in-setting-the-agenda-and-designing-research-to-reduce-impacts-of-complex-emergencies-combining-swarm-with-patient-and-public-involvement
#15
Julii Suzanne Brainard, Enana Al Assaf, Judith Omasete, Steve Leach, Charlotte C Hammer, Paul R Hunter
Plain English summary: The UK's National Institute for Health Research (NIHR) Health Protection Research Unit in Emergency Preparedness and Response was asked to undertake research on how to reduce the impact of complex national/international emergencies on public health. How to focus the research and decide on priority topics was challenging, given the nature of complex events. Using a type of structured brain-storming, the researchers identified the ongoing UK, European and international migration crisis as both complex and worthy of deeper research...
2017: Res Involv Engagem
https://www.readbyqxmd.com/read/29142021/inf2-mediated-actin-polymerization-at-the-er-stimulates-mitochondrial-calcium-uptake-inner-membrane-constriction-and-division
#16
Rajarshi Chakrabarti, Wei-Ke Ji, Radu V Stan, Jaime de Juan Sanz, Timothy A Ryan, Henry N Higgs
Mitochondrial division requires division of both the inner and outer mitochondrial membranes (IMM and OMM, respectively). Interaction with endoplasmic reticulum (ER) promotes OMM division by recruitment of the dynamin Drp1, but effects on IMM division are not well characterized. We previously showed that actin polymerization through ER-bound inverted formin 2 (INF2) stimulates Drp1 recruitment in mammalian cells. Here, we show that INF2-mediated actin polymerization stimulates a second mitochondrial response independent of Drp1: a rise in mitochondrial matrix calcium through the mitochondrial calcium uniporter...
November 15, 2017: Journal of Cell Biology
https://www.readbyqxmd.com/read/29141912/wh2-and-proline-rich-domains-of-wasp-family-proteins-collaborate-to-accelerate-actin-filament-elongation
#17
Peter Bieling, Scott D Hansen, Orkun Akin, Tai-De Li, Carl C Hayden, Daniel A Fletcher, R Dyche Mullins
WASP-family proteins are known to promote assembly of branched actin networks by stimulating the filament-nucleating activity of the Arp2/3 complex. Here, we show that WASP-family proteins also function as polymerases that accelerate elongation of uncapped actin filaments. When clustered on a surface, WASP-family proteins can drive branched actin networks to grow much faster than they could by direct incorporation of soluble monomers. This polymerase activity arises from the coordinated action of two regulatory sequences: (i) a WASP homology 2 (WH2) domain that binds actin, and (ii) a proline-rich sequence that binds profilin-actin complexes...
November 15, 2017: EMBO Journal
https://www.readbyqxmd.com/read/29140466/transcription-induced-supercoiling-as-the-driving-force-of-chromatin-loop-extrusion-during-formation-of-tads-in-interphase-chromosomes
#18
Dusan Racko, Fabrizio Benedetti, Julien Dorier, Andrzej Stasiak
Using molecular dynamics simulations, we show here that growing plectonemes resulting from transcription-induced supercoiling have the ability to actively push cohesin rings along chromatin fibres. The pushing direction is such that within each topologically associating domain (TAD) cohesin rings forming handcuffs move from the source of supercoiling, constituted by RNA polymerase with associated DNA topoisomerase TOP1, towards borders of TADs, where supercoiling is released by topoisomerase TOPIIB. Cohesin handcuffs are pushed by continuous flux of supercoiling that is generated by transcription and is then progressively released by action of TOPIIB located at TADs borders...
November 13, 2017: Nucleic Acids Research
https://www.readbyqxmd.com/read/29140451/lipids-in-membrane-dynamics-during-autophagy-in-plants
#19
Rodrigo Enrique Gomez, Jérôme Joubès, Nicolas Valentin, Henri Batoko, Béatrice Satiat-Jeunemaître, Amélie Bernard
Autophagy is a critical pathway for plant adaptation to stress. Macroautophagy relies on the biogenesis of a specialized membrane named the phagophore that maturates into a double membrane vesicle. Proteins and lipids act synergistically to promote membrane structure and functions, yet research on autophagy has mostly focused on autophagy-related proteins while knowledge of supporting lipids in the formation of autophagic membranes remains scarce. This review expands on studies in plants with examples from other organisms to present and discuss our current understanding of lipids in membrane dynamics associated with the autophagy pathway in plants...
November 13, 2017: Journal of Experimental Botany
https://www.readbyqxmd.com/read/29139303/effects-of-chinese-urban-public-hospitals-reform-on-revenue-and-compensation-after-removing-drug-markups-case-of-nanjing
#20
Wenxi Tang, Jing Xie, Yijuan Lu, Qizhi Liu, Daniel Malone, Aixia Ma
AIMS: The State Council of China requires that all urban public hospitals must eliminate drug markups by September 2017, and that hospital drugs must be sold at the purchase price. Nanjing-the first city to implement the reform-is studied to evaluate the effects of the comprehensive reform on drug prices in public hospitals and to explore differential compensation plans. METHODS: Sixteen hospitals were selected and financial data were collected over the 48-month period before the reform and for 12 months after the reform...
November 15, 2017: Journal of Medical Economics
keyword
keyword
21238
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"