Read by QxMD icon Read


Pradipta Ranjan Rauta, Sarbani Ashe, Debasis Nayak, Bismita Nayak
Virulence-related outer membrane proteins (Omps) are expressed in bacteria (Gram-negative) such as V. cholerae and are vital to bacterial invasion in to eukaryotic cell and survival within macrophages that could be best candidate for development of vaccine against V. cholerae. Applying in silico approaches, the 3-D model of the Omp was developed using Swiss model server and validated byProSA and Procheck web server. The continuous stretch of amino acid sequences 26mer: RTRSNSGLLTWGDKQTITLEYGDPAL and 31mer: FFAGGDNNLRGYGYKSISPQDASGALTGAKY having B-cell binding sites were selected from sequence alignment after B cell epitopes prediction by BCPred and AAP prediction modules of BCPreds...
October 12, 2016: Computational Biology and Chemistry
Przemysław Sawicki, Michał Białek
Typical research on intertemporal choice utilizes a two-alternative forced choice (2AFC) paradigm requiring participants to choose between a smaller sooner and larger later payoff. In the adjusting-amount procedure (AAP) one of the alternatives is fixed and the other is adjusted according to particular choices made by the participant. Such a method makes the alternatives unequal in status and is speculated to make the fixed alternative a reference point for choices, thereby affecting the decision made. The current study shows that fixing different alternatives in the AAP influences discount rates in intertemporal choices...
2016: PloS One
Daniel T Goon, Constance A Nsibambi, Milton Chebet
BACKGROUND: Scant information exist on screen time behavior of South Africa children and whether they do not meet the recommendation of American Association of Pediatrics (AAP) concerning screen time activity for children is only speculative. Therefore, the purpose of this study was to examine the time spent in sedentary activities, especially screen time of South African children with regard to gender. METHODS: This cross-sectional study involved a random sample of 1136 school children (548 boys; 588 girls) aged 9-13 years attending public schools in Central Pretoria, South Africa...
December 2016: Minerva Pediatrica
Wanjiku F M Njoroge, Cody A Hostutler, Billie S Schwartz, Jennifer A Mautone
There are multiple barriers to accessing high quality, evidence-based behavioral health care for children and adolescents, including stigma, family beliefs, and the significant paucity of child and adolescent psychiatrists. Although equal access continues to be an unmet need in the USA, there is growing recognition that integrated behavioral health services in pediatric primary care have the potential to reduce health disparities and improve service utilization. In a joint position paper, the American Academy of Pediatrics (AAP) and the American Academy of Child and Adolescent Psychiatry (AACAP) highlighted the multiple benefits of children receiving initial behavioral health screening, assessment, and evidence-based behavioral health treatments in the medical home...
December 2016: Current Psychiatry Reports
Ronaldo Custodio de Souza Oliveira, Rodrigo José Corrêa, Raquel Simas Pereira Teixeira, Daniela Dias Queiroz, Rodrigo da Silva Souza, Simon John Garden, Nanci Camara de Lucas, Marcos Dias Pereira, Josué Sebastián Bello Forero, Eric Cardona Romani, Emerson Schwingel Ribeiro
In the present study, SiO2 nanoparticles functionalized with 3-(2-aminoethylamino)propyl group (SiNP-AAP) were used, for the first time, to covalently bond rose bengal (SiNP-AAP-RB) or 9,10-anthraquinone-2-carboxylic acid (SiNP-AAP-OCAq). The functionalized SiNP were characterized by: Scanning Electron Microscopy (SEM), Transmission Electron Microscopy (TEM); elemental analysis (CHN) for determination of the dye concentration; FTIR and UV-vis diffuse reflectance (DR-UV-vis) and a surface area study (BET). The functionalized SiNPs were applied in photodynamic therapy (PDT) against lung cancer cell lines...
October 13, 2016: Journal of Photochemistry and Photobiology. B, Biology
Chang Amber Liu, Jinghu Sui, Charles J Coté, Thomas A Anderson
BACKGROUND AND OBJECTIVES: Caudal anesthesia is a common and effective regional anesthesia technique in pediatric patients. The addition of epinephrine to local anesthetics in caudal anesthesia is a frequent practice; however, changes in hemodynamic and cardiac parameters produced by epinephrine in caudal anesthesia are not well studied. Using data collected with the ICON noninvasive cardiac output monitor, we examined the hemodynamic changes associated with the administration of epinephrine containing local anesthetics during caudal anesthesia in children...
October 11, 2016: Regional Anesthesia and Pain Medicine
Angela M Zeng, Nina F Nami, Christopher L Wu, Jamie D Murphy
BACKGROUND AND OBJECTIVES: Postoperative pain after cesarean delivery, which accounts for approximately 1 in 3 live births in the United States, can be severe in many patients. Nonsteroidal anti-inflammatory agents (NSAIDs) are potent analgesics that are effective in the treatment of postoperative pain. In this meta-analysis, we assessed the analgesic efficacy of NSAIDs in postoperative cesarean delivery patients. METHODS: An electronic literature search of the Library of Medicine's PubMed, Cochrane CENTRAL, Scopus, and EMBASE databases was conducted in May 2013 and updated in January 2015 (Appendix, Supplemental Digital Content 1, http://links...
October 11, 2016: Regional Anesthesia and Pain Medicine
Sigal Zilcha-Mano
Many therapists regard alliance ruptures as one of the greatest challenges therapists face in the therapy room. Alliance ruptures has been previously defined as breakdowns in the process of negotiation of treatment tasks and goals and a deterioration in the affective bond between patient and therapist. Alliance ruptures have been found to predict premature termination of treatment and poor treatment outcomes. But ruptures can also present important opportunities for gaining insight and awareness and for facilitating therapeutic change...
October 17, 2016: Clinical Child Psychology and Psychiatry
Carolyn R Schaeffer, Tra-My N Hoang, Craig M Sudbeck, Malik Alawi, Isaiah E Tolo, D Ashley Robinson, Alexander R Horswill, Holger Rohde, Paul D Fey
Staphylococcus epidermidis is a leading cause of hospital-associated infections, including those of intravascular catheters, cerebrospinal fluid shunts, and orthopedic implants. Multiple biofilm matrix molecules with heterogeneous characteristics have been identified, including proteinaceous, polysaccharide, and nucleic acid factors. Two of the best-studied components in S. epidermidis include accumulation-associated protein (Aap) and polysaccharide intercellular adhesin (PIA), produced by the enzymatic products of the icaADBC operon...
September 2016: MSphere
Liat Shani
Animal-assisted psychotherapy (AAP) inherently incorporates standpoints, interventions, and ways of action promoting the development of the reflective function and mentalization, and thus has special value for parent-child psychotherapy. Two central tools in AAP contribute to this process. The first is the ethical stance of the therapist, who sees the animals as full partners in the therapy situation, respecting them as subjects with needs, desires, and thoughts of their own. The second tool combines nonverbal communication with animals together with the relating, in the here and now, to the understanding and decoding of body language of everyone in the setting...
October 14, 2016: Clinical Child Psychology and Psychiatry
Aylin Tugcu, Zhezhen Jin, Shunichi Homma, Mitchell S V Elkind, Tatjana Rundek, Mitsuhiro Yoshita, Charles DeCarli, Koki Nakanishi, Sofia Shames, Clinton B Wright, Ralph L Sacco, Marco R Di Tullio
BACKGROUND AND PURPOSE: Aortic arch plaque (AAP) is a risk factor for ischemic stroke, but its association with subclinical cerebrovascular disease is not established. We investigated the association between AAP and subclinical cerebrovascular disease in an elderly stroke-free community-based cohort. METHODS: The CABL study (Cardiovascular Abnormalities and Brain Lesions) was designed to investigate cardiovascular predictors of silent cerebrovascular disease in the elderly...
October 11, 2016: Stroke; a Journal of Cerebral Circulation
Jaffer A Shariff, Kavita P Ahluwalia, Panos N Papapanou
BACKGROUND: Recreational use of cannabis following its legalization in several countries poses an emergent oral and periodontal health concern. The objective of this study was to examine the relationship between frequent recreational cannabis (marijuana and hashish) use and periodontitis prevalence among U.S adults. METHODS: Data from the National Health and Nutrition Examination Survey (NHANES 2011-12) were analyzed. The primary outcome (periodontitis) was defined using the CDC/AAP classification as well as continuous measurements of probing depth (PD) and clinical attachment loss (AL)...
October 8, 2016: Journal of Periodontology
Linda C Lee, Armando J Lorenzo, Martin A Koyle
Urinary tract infections (UTIs) represent a common bacterial cause of febrile illness in children. Of children presenting with a febrile UTI, 25-40% are found to have vesicoureteral reflux (VUR). Historically, the concern regarding VUR was that it could lead to recurrent pyelonephritis, renal scarring, hypertension, and chronic kidney disease. As a result, many children underwent invasive surgical procedures to correct VUR. We now know that many cases of VUR are low-grade and have a high rate of spontaneous resolution...
May 2016: Canadian Urological Association Journal, Journal de L'Association des Urologues du Canada
Susanna Pallini, Agnese Alfani, Lucrezia Marech, Fiorenzo Laghi
OBJECTIVES: Women victims of IPV are more likely insecurely attached and have experienced childhood abuse, which according to the attachment theory is deeply related to disorganized attachment. This case-control study was performed with the aim to compare the attachment status and the defensive processing patterns of women victims of IPV (cases) with women with no experiences of IPV (controls). METHODS: Cases were 16 women with an age range from 26 years to 51 years...
October 4, 2016: Psychology and Psychotherapy
Cassandra C Brady, Vidhu V Thaker, Todd Lingren, Jessica G Woo, Stephanie S Kennebeck, Bahram Namjou-Khales, Ashton Roach, Jonathan P Bickel, Nandan Patibandla, Guergana K Savova, Imre Solti, Ingrid A Holm, John B Harley, Isaac S Kohane, Nancy A Crimmins
Background and Objectives. The prevalence of severe obesity in children has doubled in the past decade. The objective of this study is to identify the clinical documentation of obesity in young children with a BMI ≥ 99th percentile at two large tertiary care pediatric hospitals. Methods. We used a standardized algorithm utilizing data from electronic health records to identify children with severe early onset obesity (BMI ≥ 99th percentile at age <6 years). We extracted descriptive terms and ICD-9 codes to evaluate documentation of obesity at Boston Children's Hospital and Cincinnati Children's Hospital and Medical Center between 2007 and 2014...
2016: International Journal of Pediatrics
Milagro Fernández-Delgado, Jackeline Cortez, Guiden Sulbarán, César Matos, Renzo Nino Incani, Diana E Ballén, Italo M Cesari
Schistosoma mansoni enzymes play important roles in host-parasite interactions and are potential targets for immunological and/or pharmacological attack. The aim of this study was to comparatively assess the presence of hydrolytic activities (phosphatases, glycosidases, aminopeptidases) in soluble (SF) and membrane (MF) fractions from different S. mansoni developmental stages (schistosomula 0 and 3h, juveniles, and adult worms of 28 and 45days-old, respectively), by using simple enzyme-substrate microassays...
September 28, 2016: Parasitology International
R Večeřová, K Bogdanová, D Rejman, J Gallo, M Kolář
OBJECTIVE: The study aimed at determining the ability of lipophosphonoxin DR5026 to inhibit the formation of bacterial biofilm on the bone cement surface and assessing potential development of bacterial resistance. MATERIAL AND METHODS: Bone cement (Hi-Fatigue Bone Cement 2x40, aap Biomaterials GmbH, Germany) was polymerized with lipophosphonoxin DR5026. Cement samples were cultured using bacterial suspension containing Staphylococcus epidermidis CCM7221 at an inoculum density of 106 CFU/mL...
2016: Epidemiologie, Mikrobiologie, Imunologie
Diane Grillault Laroche, Adeline Gaillard
The prevalence of OCS and OCD is higher in schizophrenic patients than in the general population. These disorders are sometimes induced by AAPs. There is higher frequency of OCS and greater severity in patients treated with antipsychotics with predominant anti-serotoninergic profiles opposed to those with predominant dopaminergic blockade. Induced OCS may be due to complex neuromodulation involving many serotonin, dopamine and glutamate receptors and several subtypes. Concerning connectivity, AAPs differentially influence the BOLD signal, depending on the intensity of D2 receptor blockade...
September 21, 2016: Psychiatry Research
Jun Zheng, Ziying Cheng, Honglin Jia, Yonghui Zheng
Aminopeptidases have emerged as new promising drug targets for the development of novel anti-parasitic drugs. An aspartyl aminopeptidase-like gene has been identified in the Toxoplasma gondii genome (TgAAP), although its function remains unknown. In this study, we characterized TgAAP and performed functional analysis of the gene product. Firstly, we expressed a functional recombinant TgAAP (rTgAAP) protein in Escherichia coli, and found that it required metal ions for activity and showed a substrate preference for N-terminal acidic amino acids Glu and Asp...
September 28, 2016: Scientific Reports
Zouhir Boukara, A C Nouar, Mostefa Bedjaoui, O Bensaber, A Lahmer
OBJECTIVE: The post-polio syndrome (PPS), clinical entity that occurs at least 15 years of stability after acute polio results in specific symptoms. If its pathophysiology remains unsolved its functional impact is considerable. The objectives are two folds, establish the epidemiological profile and search the harmful elements for its prevention. MATERIALS/PATIENTS AND METHODS: Prospective descriptive study, from 2010 to 2013, about 104 former polio victims. The tools: pain-scale, fatigue-scale of Borg and a preset plug for data collection, including historical elements of polio and diagnostic criteria of Halstead...
September 2016: Annals of Physical and Rehabilitation Medicine
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"