keyword
MENU ▼
Read by QxMD icon Read
search

Antimicrobial resistance

keyword
https://www.readbyqxmd.com/read/29150724/presence-of-chlamydia-trachomatis-and-mycoplasma-spp-but-not-neisseria-gonorrhoeae-and-treponema-pallidum-in-women-undergoing-an-infertility-evaluation-high-prevalence-of-tetracycline-resistance-gene-tet-m
#1
Min Li, Xiaomei Zhang, Ke Huang, Haixiang Qiu, Jilei Zhang, Yuan Kang, Chengming Wang
Chlamydia trachomatis, Mycoplasma spp., Neisseria gonorrhoeae and Treponema pallidum are sexually transmitted pathogens that threaten reproductive health worldwide. In this study, vaginal swabs obtained from women (n = 133) that attended an infertility clinic in China were tested with qPCRs for C. trachomatis, Mycoplasma spp., N. gonorrhoeae, T. pallidum and tetracycline resistance genes. While none of vaginal swabs were positive for N. gonorrhoeae and T. pallidum, 18.8% (25/133) of the swabs were positive for Chlamydia spp...
November 17, 2017: AMB Express
https://www.readbyqxmd.com/read/29150510/characterization-of-vibrio-parahaemolyticus-and-vibrio-vulnificus-recovered-from-oysters-during-an-oyster-relay-study
#2
Sara Elmahdi, Salina Parveen, Sylvia Ossai, Ligia V DaSilva, Michael Jahncke, John Bowers, John Jacobs
Vibrio parahaemolyticus (Vp) and Vibrio vulnificus (Vv) are naturally occurring estuarine bacteria and are the leading causes of seafood-associated infections and mortality in the USA. Though multiple-antibiotic resistant Vp and Vv have been reported resistance patterns in vibrios are not as well documented as other food-borne bacterial pathogens. Salinity relaying (SR) is a Post-Harvest Processing (PHP) treatment to reduce the abundance of these pathogens in shellfish harvested during the warmer months. The purpose of this study was to evaluate the antimicrobial susceptibility (AMS), pathogenicity and genetic profiles of Vp and Vv recovered from oysters during an oyster relay study...
November 17, 2017: Applied and Environmental Microbiology
https://www.readbyqxmd.com/read/29150378/enhanced-antibacterial-effects-of-green-synthesized-zno-nps-using-aristolochia-indica-against-multi-drug-resistant-bacterial-pathogens-from-diabetic-foot-ulcer
#3
Katherin Steffy, G Shanthi, Anson S Maroky, S Selvakumar
BACKGROUND: Increased incidence of Multi-drug resistance in microorganisms has become the greatest challenge in the treatment of Diabetic Foot Ulcer (DFU) and urges the need of a new antimicrobial agent. In this study, we determined the bactericidal effects of ZnO nanoparticles (ZnO NPs) green synthesized from Aristolochia indica against Multi-drug Resistant Organisms (MDROs) isolated from pus samples of DFU patients attending in a tertiary care hospital in South India. METHODS: ZnO NPs were characterized by UV-vis-DRS spectroscopy, Atomic Force Microscopy (AFM), Transmission Electron Microscopy (TEM) and for its zeta potential value...
November 14, 2017: Journal of Infection and Public Health
https://www.readbyqxmd.com/read/29149094/genomic-analysis-of-third-generation-cephalosporin-resistant-escherichia-coli-from-dairy-cow-manure
#4
Muhammad Attiq Rehman, Xianhua Yin, Dion Lepp, Chad Laing, Kim Ziebell, Guylaine Talbot, Edward Topp, Moussa Sory Diarra
The production of extended-spectrum β-lactamases (ESBLs) conferring resistance to new derivatives of β-lactams is a major public health threat if present in pathogenic Gram-negative bacteria. The objective of this study was to characterize ceftiofur (TIO)- or cefotaxime (FOX)-resistant Escherichia coli isolated from dairy cow manure. Twenty-four manure samples were collected from four farms and incubated under anaerobic conditions for 20 weeks at 4 °C or at 25 °C. A total of 37 TIO- or FOX-resistant E. coli were isolated from two of the four farms to determine their susceptibility to 14 antibiotics...
November 17, 2017: Veterinary Sciences
https://www.readbyqxmd.com/read/29148877/characterization-and-horizontal-transfer-of-antimicrobial-resistance-genes-and-integrons-in-bacteria-isolated-from-cooked-meat-products-in-china
#5
Tao Yu, Xiaobing Jiang, Yu Liang, Yanping Zhu, Jinhe Tian, Hao Ying, Xuannian Wang, Lei Shi
The aim of this study was to investigate antimicrobial resistance and the presence and transferability of corresponding resistance genes and integrons in bacteria isolated from cooked meat samples in the People's Republic of China. A total of 150 isolates (22 species belonging to 15 genera) were isolated from 49 samples. Resistance of these isolates to antimicrobials was commonly observed; 42.7, 36.0, and 25.3% of the isolates were resistant to tetracycline, streptomycin, and ampicillin, respectively. Multidrug resistance was observed in 41 (27...
November 17, 2017: Journal of Food Protection
https://www.readbyqxmd.com/read/29147677/antimicrobial-resistance-profiles-of-bacteria-isolated-from-the-nasal-cavity-of-camels-in-samburu-nakuru-and-isiolo-counties-of-kenya
#6
J M Mutua, C G Gitao, L C Bebora, F K Mutua
This study was designed to determine antimicrobial resistance profiles of bacteria isolated from the nasal cavity of healthy camels. A total of 255 nasal samples (swabs) were collected in Isiolo, Samburu, and Nakuru counties, Kenya, from which 404 bacterial isolates belonging to various genera and species were recovered. The bacterial isolates included Bacillus (39.60%), coagulase-negative Staphylococcus (29.95%), Streptococcus species other than Streptococcus agalactiae (25.74%), coagulase-positive Staphylococcus (3...
2017: Journal of veterinary medicine
https://www.readbyqxmd.com/read/29147555/what-can-machine-learning-do-for-antimicrobial-peptides-and-what-can-antimicrobial-peptides-do-for-machine-learning
#7
REVIEW
Ernest Y Lee, Michelle W Lee, Benjamin M Fulan, Andrew L Ferguson, Gerard C L Wong
Antimicrobial peptides (AMPs) are a diverse class of well-studied membrane-permeating peptides with important functions in innate host defense. In this short review, we provide a historical overview of AMPs, summarize previous applications of machine learning to AMPs, and discuss the results of our studies in the context of the latest AMP literature. Much work has been recently done in leveraging computational tools to design new AMP candidates with high therapeutic efficacies for drug-resistant infections...
December 6, 2017: Interface Focus
https://www.readbyqxmd.com/read/29147502/chemical-space-guided-discovery-of-antimicrobial-bridged-bicyclic-peptides-against-pseudomonas-aeruginosa-and-its-biofilms
#8
Ivan Di Bonaventura, Xian Jin, Ricardo Visini, Daniel Probst, Sacha Javor, Bee-Ha Gan, Gaëlle Michaud, Antonino Natalello, Silvia Maria Doglia, Thilo Köhler, Christian van Delden, Achim Stocker, Tamis Darbre, Jean-Louis Reymond
Herein we report the discovery of antimicrobial bridged bicyclic peptides (AMBPs) active against Pseudomonas aeruginosa, a highly problematic Gram negative bacterium in the hospital environment. Two of these AMBPs show strong biofilm inhibition and dispersal activity and enhance the activity of polymyxin, currently a last resort antibiotic against which resistance is emerging. To discover our AMBPs we used the concept of chemical space, which is well known in the area of small molecule drug discovery, to define a small number of test compounds for synthesis and experimental evaluation...
October 1, 2017: Chemical Science
https://www.readbyqxmd.com/read/29146890/effectiveness-of-topical-green-tea-against-multidrug-resistant-staphylococcus-aureus-in-cases-of-primary-pyoderma-an-open-controlled-trial
#9
Nagaraju Umashankar, Belliappa Pemmanda, P Gopkumar, A J Hemalatha, Priya K Sundar, H V Prashanth
BACKGROUND: Antimicrobial activity of green tea against Staphylococcus aureus both in vitro and in vivo has been reported recently. Studies on clinical efficacy and safety of green tea as antibacterial agent against S. aureus in human cases are rare. OBJECTIVES: To evaluate the clinical effectiveness and safety of topical green tea on primary pyoderma caused by S. aureus. We also attempted to determine the minimum inhibitory concentration of green tea against S...
November 14, 2017: Indian Journal of Dermatology, Venereology and Leprology
https://www.readbyqxmd.com/read/29146833/draft-genome-sequences-of-eight-streptogramin-resistant-enterococcus-species-isolated-from-animal-and-environmental-sources-in-the-united-states
#10
Poonam Sharma, Sushim Kumar Gupta, John B Barrett, Lari M Hiott, Sandra L House, Tiffanie A Woodley, Jonathan G Frye, Charlene R Jackson
Here, we present the draft genome sequences of eight streptogramin-resistant Enterococcus species isolated from animals and an environmental source in the United States from 2001 to 2004. Antimicrobial resistance genes were identified conferring resistance to the macrolide-lincosamide-streptogramins, aminoglycosides, tetracyclines, beta-lactams, and glycopeptides.
November 16, 2017: Genome Announcements
https://www.readbyqxmd.com/read/29146499/antimicrobial-resistance-and-virulence-genes-profiling-of-methicillin-resistant-staphylococcus-aureus-isolates-in-a-burn-center-a-5-year-study
#11
Bei Jiang, Supeng Yin, Bo You, Yali Gong, Guangtao Huang, Zichen Yang, Yulong Zhang, Yu Chen, Jing Chen, Zhiqiang Yuan, Xiaomei Hu, Yizhi Peng
Methicillin-resistant S. aureus (MRSA) has attracted more and more attention in recent years, especially in burn medical centers. Here we conducted a 5-year period study to evaluate the MRSA infection in our burn center. The staphylococcal chromosomal cassette mec (SCCmec) typing, antimicrobials susceptibility and virulence profiles were also performed among the MRSA isolates. Of the 259 S. aureus isolates, 239 (92.28%) isolates were identified as MRSA. A decreased trend of MRSA isolation rate over time was found (P = 0...
November 13, 2017: Microbial Pathogenesis
https://www.readbyqxmd.com/read/29146383/not-just-antibiotics-is-cancer-chemotherapy-driving-antimicrobial-resistance
#12
REVIEW
Lito E Papanicolas, David L Gordon, Steve L Wesselingh, Geraint B Rogers
The global spread of antibiotic-resistant pathogens threatens to increase the mortality of cancer patients significantly. We propose that chemotherapy contributes to the emergence of antibiotic-resistant bacteria within the gut and, in combination with antibiotics, drives pathogen overgrowth and translocation into the bloodstream. In our model, these processes are mediated by the effects of chemotherapy on bacterial mutagenesis and horizontal gene transfer, the disruption of commensal gut microbiology, and alterations to host physiology...
November 13, 2017: Trends in Microbiology
https://www.readbyqxmd.com/read/29146304/extensive-evaluation-of-fastidious-anaerobic-bacteria-recovery-from-the-copan-eswab%C3%A2-transport-system
#13
Thomas Demuyser, Deborah De Geyter, Daisy Van Dorpe, Kristof Vandoorslaer, Ingrid Wybo
Anaerobic infections are difficult to diagnose and treat, because of the often slow in vitro growth, the polymicrobial nature and the increasing antimicrobial resistance. Furthermore because of their fastidiousness, anaerobic bacteria often stay unrecognized in clinical practice. Clinical specimens potentially harboring these species require special handling to permit satisfactory recovery of these potential important pathogens. In a clinical setting, temporary storage and transportation to the laboratory are unavoidable before these specimens can be cultured...
November 13, 2017: Journal of Microbiological Methods
https://www.readbyqxmd.com/read/29146261/a-comprehensive-review-of-non-enterica-subspecies-of-salmonella-enterica
#14
REVIEW
Alexandre Lamas, José Manuel Miranda, Patricia Regal, Beatriz Vázquez, Carlos Manuel Franco, Alberto Cepeda
Salmonella is a major foodborne pathogen with a complex nomenclature. This genus is composed of two species, S. enterica and S. bongori. S. enterica is divided into six subspecies. S. enterica subspecies enterica is composed of more than 1500 serotypes with some of great importance, such as S. Typhimurium and S. Enteritidis. S. enterica subsp. enterica is responsible of more than 99% of human salmonellosis and therefore it is widely studied. However, the non-enterica subspecies of S. enterica have been little studied...
January 2018: Microbiological Research
https://www.readbyqxmd.com/read/29146256/isolation-purification-structural-elucidation-and-antimicrobial-activities-of-kocumarin-a-novel-antibiotic-isolated-from-actinobacterium-kocuria-marina-cmg-s2-associated-with-the-brown-seaweed-pelvetia-canaliculata
#15
Bushra Uzair, Farid Menaa, Barkat Ali Khan, Faryal Vali Mohammad, Viqar Uddin Ahmad, Ryad Djeribi, Bouzid Menaa
AIMS: Screening of seaweed-associated bacteria capable of producing antimicrobials. METHODS AND RESULTS: Fifteen microbial strains, associated to the brown seaweed Pelvetia canaliculata (Linnaeus) attached to the rocks of Sonmiani Beach (Karachi, Pakistan), were screened. Crude extract filtrates of CMG S2 strain grew on Zobell marine agar (ZMA) had the most remarkable antimicrobial activity. Based on its phenotypic aspects (e.g. Gram-positive, microccoid form), biochemical characteristics (e...
January 2018: Microbiological Research
https://www.readbyqxmd.com/read/29145971/antimicrobial-blue-light-inactivation-of-pathogenic-microbes-state-of-the-art
#16
Yucheng Wang, Ying Wang, Yuguang Wang, Clinton K Murray, Michael R Hamblin, David C Hooper, Tianhong Dai
As an innovative non-antibiotic approach, antimicrobial blue light in the spectrum of 400-470nm has demonstrated its intrinsic antimicrobial properties resulting from the presence of endogenous photosensitizing chromophores in pathogenic microbes and, subsequently, its promise as a counteracter of antibiotic resistance. Since we published our last review of antimicrobial blue light in 2012, there have been a substantial number of new studies reported in this area. Here we provide an updated overview of the findings from the new studies over the past 5 years, including the efficacy of antimicrobial blue light inactivation of different microbes, its mechanism of action, synergism of antimicrobial blue light with other angents, its effect on host cells and tissues, the potential development of resistance to antimicrobial blue light by microbes, and a novel interstitial delivery approach of antimicrobial blue light...
November 2017: Drug Resistance Updates: Reviews and Commentaries in Antimicrobial and Anticancer Chemotherapy
https://www.readbyqxmd.com/read/29145853/molecular-characterization-of-%C3%AE-lactamase-genes-in-clinical-isolates-of-carbapenem-resistant-acinetobacter-baumannii
#17
Kevin M Raible, Bhaswati Sen, Nancy Law, Tiffany E Bias, Christopher L Emery, Garth D Ehrlich, Suresh G Joshi
BACKGROUND: Acinetobacter baumannii is a nosocomial pathogen which is establishing as a major cause of morbidity and mortality within the healthcare community. The success of this pathogen is largely due to its ability to rapidly gain resistance to antimicrobial therapies and its capability to persist in an abiotic environment through the production of a biofilm. Our tertiary-care hospital has showed high incidence of carbapenem-resistant Acinetobacter baumannii (CRAB) isolates. METHODS: In this study we explore both genotypic and phenotypic properties of 26 CRAB isolates: 16 isolates were collected from January 2010 to March 2011, and 10 were collected between February and May 2015...
November 16, 2017: Annals of Clinical Microbiology and Antimicrobials
https://www.readbyqxmd.com/read/29145465/hospital-associated-methicillin-resistant-staphylococcus-aureus-a-cross-sectional-analysis-of-risk-factors-in-south-african-tertiary-public-hospitals
#18
Liliwe L Shuping, Lazarus Kuonza, Alfred Musekiwa, Samantha Iyaloo, Olga Perovic
INTRODUCTION: Hospital-associated methicillin-resistant S. aureus (HA-MRSA) remains a significant cause of morbidity and mortality worldwide. We conducted a study to determine risk factors for HA-MRSA in order to inform control strategies in South Africa. METHODS: We used surveillance data collected from five tertiary hospitals in Gauteng and Western Cape provinces during 2014 for analysis. A case of HA-MRSA was defined as isolation of MRSA from a blood culture 48 hours after admission and/or if the patient was hospitalised in the six months prior to the current culture...
2017: PloS One
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#19
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29144958/isolation-of-blandm-producing-enterobacteriaceae-in-a-public-hospital-in-salvador-bahia-brazil
#20
Maria Goreth Barberino, Silvia de Araujo Cruvinel, Célio Faria, Marco Aurélio Salvino, Márcio Oliveira
Carbapenemases have great importance in the global epidemiological scenario since infections with carbapenemase-producing bacteria are associated with high mortality, especially in hospitalized patients in intensive care units. This study describes two microorganisms producers of the New Delhi Metallo-b-lactamase (NDM), Klebsiella pneumoniae and Citrobacter freundii, from two patients admitted to a public hospital in Salvador, Bahia. These are the first clinical cases of NDM described in microorganisms in the north and northeast Brazil...
November 13, 2017: Brazilian Journal of Infectious Diseases
keyword
keyword
188
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"