keyword
MENU ▼
Read by QxMD icon Read
search

FT-IR spectroscopy

keyword
https://www.readbyqxmd.com/read/27910790/exploring-geographical-differentiation-of-the-hoelen-medicinal-mushroom-wolfiporia-extensa-agaricomycetes-using-fourier-transform-infrared-spectroscopy-combined-with-multivariate-analysis
#1
Yan Li, Ji Zhang, Yanli Zhao, Honggao Liu, Yuanzhong Wang, Hang Jin
In this study the geographical differentiation of dried sclerotia of the medicinal mushroom Wolfiporia extensa, obtained from different regions in Yunnan Province, China, was explored using Fourier-transform infrared (FT-IR) spectroscopy coupled with multivariate data analysis. The FT-IR spectra of 97 samples were obtained for wave numbers ranging from 4000 to 400 cm-1. Then, the fingerprint region of 1800-600 cm-1 of the FT-IR spectrum, rather than the full spectrum, was analyzed. Different pretreatments were applied on the spectra, and a discriminant analysis model based on the Mahalanobis distance was developed to select an optimal pretreatment combination...
2016: International Journal of Medicinal Mushrooms
https://www.readbyqxmd.com/read/27909876/sonochemical-effect-on-activity-and-conformation-of-commercial-lipases
#2
Shamraja S Nadar, Virendra K Rathod
The enzyme under lower-intensity ultrasonic irradiation leads to favourable conformational changes, thereby enhancing its activity. The augmentation of activity of ultrasound-treated enzyme is strongly dependent on ultrasound intensity, duty cycle and exposure time, which was investigated for commercial lipases. Thermomyces lanuginosus (TL) lipase showed a 1.3-fold enhanced activity after irradiating at 22 kHz and 11.38 W cm(-2) with 50 % duty cycle for 25-min ultrasonic treatment and 1.5-fold enhanced activity was observed for lipozyme (candida antarctica lipase B (CALB)) lipase, at 22 kHz and 15...
December 1, 2016: Applied Biochemistry and Biotechnology
https://www.readbyqxmd.com/read/27908268/synthesis-of-new-fluoro-benzimidazole-derivatives-as-an-approach-towards-the-discovery-of-novel-intestinal-antiseptic-drug-candidates
#3
Ulviye Acar, Begüm Nurpelin Sağlık, Yusuf Özkay, Zerrin Cantürk, Juan Bueno, Fatih Demirci
In the present study, nineteen new fluoro-benzimidazole derivatives, including nifuroxazide analogues, were synthesized by microwave-supported reactions and tested against a panel of pathogenic microorganisms consisting of resistant strains. The synthesized compounds were characterised and identified by FT-IR, 1H- and 13C-NMR, mass spectroscopy, and elemental analyses, respectively. In vitro antimicrobial and cytotoxic effects of the synthesized compounds were determined by microdilution and by [3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide] (MTT) assay...
December 1, 2016: Current Pharmaceutical Design
https://www.readbyqxmd.com/read/27907866/chemical-profiling-and-adulteration-screening-of-aquilariae-lignum-resinatum-by-fourier-transform-infrared-ft-ir-spectroscopy-and-two-dimensional-correlation-infrared-2d-ir-spectroscopy
#4
Lei Qu, Jian-Bo Chen, Gui-Jun Zhang, Su-Qin Sun, Jing Zheng
As a kind of expensive perfume and valuable herb, Aquilariae Lignum Resinatum (ALR) is often adulterated for economic motivations. In this research, Fourier transform infrared (FT-IR) spectroscopy is employed to establish a simple and quick method for the adulteration screening of ALR. First, the principal chemical constituents of ALR are characterized by FT-IR spectroscopy at room temperature and two-dimensional correlation infrared (2D-IR) spectroscopy with thermal perturbation. Besides the common cellulose and lignin compounds, a certain amount of resin is the characteristic constituent of ALR...
November 10, 2016: Spectrochimica Acta. Part A, Molecular and Biomolecular Spectroscopy
https://www.readbyqxmd.com/read/27906480/integrating-sugar-and-dopamine-into-one-polymer-controlled-synthesis-and-robust-surface-modification
#5
Lun Peng, Zhiyun Li, Xiaohui Li, Hui Xue, Weidong Zhang, Gaojian Chen
Glycopolymers attached to a surface possess the ability to bind to certain carbohydrate binding proteins in a highly specific manner, and because of this, the fabrication of glycopolymer-modified surfaces has evolved as an effective route toward bioresponsive systems. Poly(N-3,4-dihydroxybenzenethyl methacrylamide-co-2-(methacrylamido) glucopyranose) copolymers, containing sugar and catechol functionalities, are for the first time successfully prepared in a well-controlled manner via room temperature single-electron transfer initiation and propagation through radical addition fragmentation chain transfer technique...
December 1, 2016: Macromolecular Rapid Communications
https://www.readbyqxmd.com/read/27906390/flexible-all-solid-state-supercapacitors-based-on-polyaniline-orderly-nanotubes-array
#6
Huihua Li, Juan Song, Linlin Wang, Xiaomiao Feng, Ruiqing Liu, Wenjin Zeng, Zhendong Huang, Yanwen Ma, Lianhui Wang
Flexible all-solid-state supercapacitors are crucial to meet the growing needs for portable electronic devices such as foldable phones and wearable electronics. As promising candidates for pseudocapacitor electrode materials, polyaniline (PANI) orderly nanotube arrays are prepared via a simple template electrodeposition method. The structures of the final product were characterized using various characterization techniques, including scanning electron microscopy (SEM), Fourier transform infrared spectroscopy (FT-IR), and X-ray photoelectron spectroscopy (XPS)...
December 1, 2016: Nanoscale
https://www.readbyqxmd.com/read/27905577/infrared-spectroscopy-and-spectroscopic-imaging-in-forensic-science
#7
REVIEW
Andrew V Ewing, Sergei G Kazarian
Infrared spectroscopy and spectroscopic imaging, are robust, label free and inherently non-destructive methods with a high chemical specificity and sensitivity that are frequently employed in forensic science research and practices. This review aims to discuss the applications and recent developments of these methodologies in this field. Furthermore, the use of recently emerged Fourier transform infrared (FT-IR) spectroscopic imaging in transmission, external reflection and Attenuated Total Reflection (ATR) modes are summarised with relevance and potential for forensic science applications...
December 1, 2016: Analyst
https://www.readbyqxmd.com/read/27903085/bio-medically-active-zinc-oxide-nanoparticles-synthesized-by-using-extremophilic-actinobacterium-streptomyces-sp-ma30-and-its-characterization
#8
Thangavel Shanmugasundaram, Ramasamy Balagurunathan
The present study describes the synthesis of zinc oxide nanoparticles (ZnO-NPs) using an extremophilic actinobacterial cell-free extract, supplied with aqueous zinc acetate solution. Crystalline nature, morphological features, and polydispersed nanoparticles size (15-30 nm) were identified by X-ray diffraction (XRD), atomic force and electron microscopic analysis with dynamic light scattering (DLS) study. The interaction between biomolecules and ZnO-NPs was analyzed using Fourier transform infra-red spectroscopy (FT-IR)...
November 30, 2016: Artificial Cells, Nanomedicine, and Biotechnology
https://www.readbyqxmd.com/read/27901144/a-highly-selective-synthesis-of-new-alkenylsilsesquioxanes-by-hydrosilylation-of-alkynes
#9
A Franczyk, K Stefanowska, M Dutkiewicz, D Frąckowiak, B Marciniec
Hydrosilylation of a wide group of mono- and disubstituted (symmetrical and nonsymmetrical) alkynes with 1-dimethylsiloxy-3,5,7,9,11,13,15-heptaisobutylpentacyclo-[9.5.1.1(3,9).1(5,15).1(7,13)]octasiloxane ((HSiMe2O)(i-Bu)7Si8O12, 1) in the presence of Karstedt's catalyst (Pt2(dvs)3) has been performed for the first time. A series of new 1,2-(E)-disubstituted and 1,1,2-(E)-trisubstituted ethenes with a silsesquioxane moiety were selectively afforded and fully characterized. On the basis of nuclear magnetic resonance (NMR) and infrared spectroscopy (in situ FT-IR and/or FT-IR), the influence of alkyne structure and reaction conditions on the stereoselectivity as well as on the progress of triple bond hydrosilylation catalyzed by Pt2(dvs)3 was explained...
November 30, 2016: Dalton Transactions: An International Journal of Inorganic Chemistry
https://www.readbyqxmd.com/read/27898333/chemical-synthesis-and-supercapacitive-properties-of-lanthanum-telluride-thin-film
#10
S J Patil, A C Lokhande, D-W Lee, J H Kim, C D Lokhande
Lanthanum telluride (La2Te3) thin films are synthesized via a successive ionic layer adsorption and reaction (SILAR) method. The crystal structure, surface morphology and surface wettability properties are investigated using X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), Field emission scanning electron microscopy (FE-SEM) and contact angle goniometer techniques, respectively. The La2Te3 material exhibits a specific surface area of 51m(2)g(-1) determined by Brunauer-Emmett-Teller (BET) method...
November 9, 2016: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/27897238/synergetic-signal-amplification-of-multi-walled-carbon-nanotubes-fe3o4-hybrid-and-trimethyloctadecylammonium-bromide-as-a-highly-sensitive-detection-platform-for-tetrabromobisphenol-a
#11
Feng Zhou, Yue Wang, Wei Wu, Tao Jing, Surong Mei, Yikai Zhou
In this work, we fabricated an electrochemical sensor based on trimethyloctadecylammonium bromide and multi-walled carbon nanotubes-Fe3O4 hybrid (TOAB/MWCNTs-Fe3O4) for sensitive detection of tetrabromobisphenol A (TBBPA). The nanocomposite was characterized by X-ray diffraction (XRD), transmission electron microscopy (TEM) and Fourier transform infrared spectroscopy (FT-IR) techniques. The electrochemical behaviors of TBBPA on TOAB/MWCNTs-Fe3O4 composite film modified glassy carbon electrode (GCE) were investigated by cyclic voltammetry (CV), differential pulse voltammetry (DPV) and electrochemical impedance spectroscopy (EIS) method...
November 29, 2016: Scientific Reports
https://www.readbyqxmd.com/read/27897092/an-investigation-on-intermolecular-interaction-between-bis-indolyl-methane-and-hsa-and-bsa-using-multi-technique-methods
#12
Hamid Dezhampanah, Roghaye Firouzi
Bis(indolyl)methane (BIM) as one of the main active components of anticancer and antibacterial drugs is applied in medicinal and extensive area of chemistry. In this research interaction of human and bovine serum albumins, as drug carriers with BIM was investigated using spectroscopy methods and molecular modeling study. The fluorescence quenching measurements at the rage of 293 to 310 K revealed that the quenching mechanisms for human and bovine serum albumins are static and dynamic processes, respectively...
November 29, 2016: Journal of Biomolecular Structure & Dynamics
https://www.readbyqxmd.com/read/27896788/facile-synthesis-and-high-photocatalytic-degradation-performance-of-zno-sno2-hollow-spheres
#13
Changqing Jin, Chenghai Ge, Zengyun Jian, Yongxing Wei
ZnO-SnO2 hollow spheres were successfully synthesized through a hydrothermal method-combined carbon sphere template. The samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), and Fourier transform infrared spectroscopy (FT-IR). The average diameter of hollow spheres is about 150 nm. The photocatalytic activity of the as-prepared samples was investigated by photodegrading Rhodamine B. The results indicated that the photocatalytic activities of ZnO-SnO2 hollow spheres are higher than ZnO hollow spheres...
December 2016: Nanoscale Research Letters
https://www.readbyqxmd.com/read/27895480/synthesis-of-three-arm-block-copolymer-poly-lactic-co-glycolic-acid-poly-ethylene-glycol-with-oxalyl-chloride-and-its-application-in-hydrophobic-drug-delivery
#14
Xiaowei Zhu, Chao Liu, Jianwei Duan, Xiaoyu Liang, Xuanling Li, Hongfan Sun, Deling Kong, Jing Yang
PURPOSE: Synthesis of star-shaped block copolymer with oxalyl chloride and preparation of micelles to assess the prospect for drug-carrier applications. MATERIALS AND METHODS: Three-arm star block copolymers of poly(lactic-co-glycolic acid) (3S-PLGA)-polyethylene glycol (PEG) were synthesized by ring-opening polymerization, then PEG as the hydrophilic block was linked to the terminal hydroxyl of 3S-PLGA with oxalyl chloride. Fourier-transform infrared (FT-IR) spectroscopy, gel-permeation chromatography (GPC), hydrogen nuclear magnetic resonance ((1)H-NMR) spectra, and differential scanning calorimetry were employed to identify the structure and properties of 3S-PLGA-PEG...
2016: International Journal of Nanomedicine
https://www.readbyqxmd.com/read/27894779/chrysin-cocrystals-characterization-and-evaluation
#15
Renu Chadha, Yashika Bhalla, Avdesh Nandan, Kunal Chadha, Maninder Karan
Solvent free mechanochemical approach is utilized to synthesise new cocrystals of chrysin using supramolecular chemistry based upon reliable synthons. Chrysin, a flavone nutraceutical with wide range of beneficial effects has critically low bioavailability on account of its poor aqueous solubility and consequently poor absorption from the gastrointestinal tract. The present study focuses on this critical aspect and has exploited non covalent interactions to prepare its cocrystals with cytosine and thiamine hydrochloride...
November 3, 2016: Journal of Pharmaceutical and Biomedical Analysis
https://www.readbyqxmd.com/read/27889340/purification-and-characterization-of-an-antibacterial-and-anti-inflammatory-polypeptide-from-arca-subcrenata
#16
Yuyan Chen, Chunlei Li, Jianhua Zhu, Wangshi Xie, Xianjing Hu, Liyan Song, Jiachen Zi, Rongmin Yu
A polypeptide coded as PGC was isolated from Arca subcrenata muscle using ion exchange, Sephadex G-50 gel chromatography and RP-HPLC. PGC was identified to be a homogeneous compound by Native-PAGE and the purity was more than 98.9% measured by HPLC. The isoelectric point of PGC was determined to be 9.76 by IEF-PAGE. The molecular weight was determined to be 15973.0Da by ESI-MS/MS. The conformational structure of PGC was characterized by UV-vis, FT-IR and CD spectroscopy. N terminal amino acid sequence of PGC was shown as PSVYDAAAQLTADVKKDLRDSWKVIGGDKKGNGVA by Edman degradation...
November 23, 2016: International Journal of Biological Macromolecules
https://www.readbyqxmd.com/read/27888712/sono-assisted-adsorption-of-a-textile-dye-on-milk-vetch-derived-charcoal-supported-by-silica-nanopowder
#17
Sahand Jorfi, Reza Darvishi Cheshmeh Soltani, Mehdi Ahmadi, Alireza Khataee, Mahdi Safari
This study was performed to assess the efficiency of silica nanopowder (SNP)/milk vetch-derived charcoal (MVDC) nanocomposite coupled with the ultrasonic irradiation named sono-adsorption process for treating water-contained Basic Red 46 (BR46) dye. Field emission scanning electron microscopy (FE-SEM), X-ray diffraction (XRD), Brunauer-Emmett-Teller (BET) and Fourier transform infrared spectroscopy (FT-IR) were performed for the characterization of as-prepared adsorbent. The sono-assisted adsorption process was optimized using response surface optimization on the basis of central composite design by the application of quadratic model...
November 23, 2016: Journal of Environmental Management
https://www.readbyqxmd.com/read/27888010/indole-3-acetic-acid-diol-based-ph-sensitive-biological-macromolecule-for-antibacterial-antifungal-and-antioxidant-applications
#18
Chitra G, Franklin D S, Sudarsan S, Sakthivel M, Guhanathan S
Indole-3-acetic acid (IAA)/diol based pH-sensitive biopolymeric hydrogels with tunable biological properties (cytotoxicity, anti-oxidant and anti-fungal) have been synthesized via condensation polymerization. The present study focused on the synthesis of heterocyclic hydrogel using citric acid (CA), indole-3-acetic acid (IAA) and diethylene glycol (DEG) by condensation polymerization. The hydrogels revealed a pH-sensitive swelling behaviour, with increased swelling in acidic media, then turns to decreased the swelling in the basic media...
November 22, 2016: International Journal of Biological Macromolecules
https://www.readbyqxmd.com/read/27886594/proposed-binding-mechanism-of-galbanic-acid-extracted-from-ferula-assa-foetida-to-dna
#19
F Ahmadi, Y Shokoohinia, Sh Javaheri, H Azizian
Recently, galbanic acid (GA), a sesquiterpenoid coumarin, has been introduced as an apoptotic and geno/cytotoxicity agent. In the present study, GA has been extracted from Ferula assa-foetida, a native medicinal plant in Iran, and characterized by (1)H NMR, mass spectroscopy. Additionally, spectroscopic studies have been performed in order to investigate its DNA-interaction mode. The electrochemical behavior of GA has been studied by cyclic voltammetry (CV) in various scan rates. In neutral media (pH=7.3) one irreversible cathodic peak was obtained at -1...
November 16, 2016: Journal of Photochemistry and Photobiology. B, Biology
https://www.readbyqxmd.com/read/27886514/sugar-based-novel-niosomal-nanocarrier-system-for-enhanced-oral-bioavailability-of-levofloxacin
#20
Muhammad Imran, Muhammad Raza Shah, Farhat Ullah, Shafi Ullah, Abdelbary M A Elhissi, Waqas Nawaz, Farid Ahmad, Abdul Sadiq, Imdad Ali
CONTEXT: Vesicular systems have attracted great attention in drug delivery because of their amphiphilicity, biodegradability, non-toxicity and potential for increasing drug bioavailability. OBJECTIVE: A novel sugar-based double-tailed surfactant containing renewable block was synthesized for preparing niosomal vesicles that could be exploited for Levofloxacin encapsulation, aiming to increase its oral bioavailability. MATERIALS AND METHODS: The surfactant was characterized by (1)H NMR, mass spectroscopy and Fourier transform infrared spectroscopy (FT-IR)...
November 2016: Drug Delivery
keyword
keyword
14377
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"