keyword
MENU ▼
Read by QxMD icon Read
search

Anti paging

keyword
https://www.readbyqxmd.com/read/27898136/pharmacological-approaches-for-the-management-of-persistent-pain-in-older-adults-what-nurses-need-to-know
#1
Fabio Guerriero, Ruth Bolier, Janet H Van Cleave, M Cary Reid
HOW TO OBTAIN CONTACT HOURS BY READING THIS ARTICLE INSTRUCTIONS 1.4 contact hours will be awarded by Villanova University College of Nursing upon successful completion of this activity. A contact hour is a unit of measurement that denotes 60 minutes of an organized learning activity. This is a learner-based activity. Villanova University College of Nursing does not require submission of your answers to the quiz. A contact hour certificate will be awarded once you register, pay the registration fee, and complete the evaluation form online at http://goo...
December 1, 2016: Journal of Gerontological Nursing
https://www.readbyqxmd.com/read/27889340/purification-and-characterization-of-an-antibacterial-and-anti-inflammatory-polypeptide-from-arca-subcrenata
#2
Yuyan Chen, Chunlei Li, Jianhua Zhu, Wangshi Xie, Xianjing Hu, Liyan Song, Jiachen Zi, Rongmin Yu
A polypeptide coded as PGC was isolated from Arca subcrenata muscle using ion exchange, Sephadex G-50 gel chromatography and RP-HPLC. PGC was identified to be a homogeneous compound by Native-PAGE and the purity was more than 98.9% measured by HPLC. The isoelectric point of PGC was determined to be 9.76 by IEF-PAGE. The molecular weight was determined to be 15973.0Da by ESI-MS/MS. The conformational structure of PGC was characterized by UV-vis, FT-IR and CD spectroscopy. N terminal amino acid sequence of PGC was shown as PSVYDAAAQLTADVKKDLRDSWKVIGGDKKGNGVA by Edman degradation...
November 23, 2016: International Journal of Biological Macromolecules
https://www.readbyqxmd.com/read/27855179/analysis-of-web-spam-for-non-english-content-toward-more-effective-language-based-classifiers
#3
Mansour Alsaleh, Abdulrahman Alarifi
Web spammers aim to obtain higher ranks for their web pages by including spam contents that deceive search engines in order to include their pages in search results even when they are not related to the search terms. Search engines continue to develop new web spam detection mechanisms, but spammers also aim to improve their tools to evade detection. In this study, we first explore the effect of the page language on spam detection features and we demonstrate how the best set of detection features varies according to the page language...
2016: PloS One
https://www.readbyqxmd.com/read/27854308/characterization-of-chemically-induced-bacterial-ghosts-bgs-using-sodium-hydroxide-induced-vibrio-parahaemolyticus-ghosts-vpgs
#4
Hyun Jung Park, Sung Oh, Nagarajan Vinod, Seongmi Ji, Han Byul Noh, Jung Mo Koo, Su Hyeong Lee, Sei Chang Kim, Ki-Sung Lee, Chang Won Choi
Acellular bacterial ghosts (BGs) are empty non-living bacterial cell envelopes, commonly generated by controlled expression of the cloned lysis gene E of bacteriophage PhiX174. In this study, Vibrio parahaemolyticus ghosts (VPGs) were generated by chemically-induced lysis and the method is based on minimum inhibitory concentration (MIC) of sodium hydroxide (NaOH), acetic acid, boric acid, citric acid, maleic acid, hydrochloric acid, and sulfuric acid. The MIC values of the respective chemicals were 3.125, 6...
November 15, 2016: International Journal of Molecular Sciences
https://www.readbyqxmd.com/read/27845547/the-study-of-extracellular-protein-fractions-of-probiotic-candidate-bacteria-on-cancerous-cell-line
#5
Samira Nozari, Mehdi Mohammadzadeh, Yousef Faridvand, Amir Tockmechi, Aliakbar Movassaghpour, Jalal Abdolalizadeh
INTRODUCTION: Probiotics are live microorganisms, habituated in the human intestine, which have a beneficial effect on our health. In spite of many reports about the anticancer effect of these bacteria in in-vivo and in-vitro, their mechanisms of action are not completely understood. The goal of this study was to compare the extracellular fractions of Lactobacillus casei and L. paracasei on the anti proliferation and apoptosis induction in K562 cell line. MATERIALS AND METHODS: L...
November 2016: Archives of Iranian Medicine
https://www.readbyqxmd.com/read/27844172/xanthines-and-phosphodiesterase-inhibitors
#6
D Spina, C P Page
Theophylline is an orally acting xanthine that has been used since 1937 for the treatment of respiratory diseases including asthma and chronic obstructive pulmonary disease (COPD). However, in most treatment guidelines, xanthines have now been consigned to third-line therapy because of their narrow therapeutic window and propensity for drug-drug interactions. However, lower than conventional doses of theophylline considered to be bronchodilator are now known to have anti-inflammatory actions of relevance to the treatment of respiratory disease...
November 15, 2016: Handbook of Experimental Pharmacology
https://www.readbyqxmd.com/read/27842618/research-on-modularized-design-and-allocation-of-infectious-disease-prevention-and-control-equipment-in-china
#7
Xin Zhao, Yun-Dou Wang, Xiao-Feng Zhang, Shu-Tian Gao, Li-Jun Guo, Li-Na Sun
For the prevention and control of newly emergent or sudden infectious diseases, we built an on-site, modularized prevention and control system and tested the equipment by using the clustering analysis method. On the basis of this system, we propose a modular equipment allocation method and 4 applications of this method for different types of infectious disease prevention and control. This will help to improve the efficiency and productivity of anti-epidemic emergency forces and will provide strong technical support for implementing more universal and serialized equipment in China...
November 15, 2016: Disaster Medicine and Public Health Preparedness
https://www.readbyqxmd.com/read/27821701/sensitivity-of-fetal-rhd-screening-for-safe-guidance-of-targeted-anti-d-immunoglobulin-prophylaxis-prospective-cohort-study-of-a-nationwide-programme-in-the-netherlands
#8
Masja de Haas, Florentine F Thurik, Catharina P B van der Ploeg, Barbera Veldhuisen, Hoang Hirschberg, Aicha Ait Soussan, Heleen Woortmeijer, Frithjofna Abbink, Godelieve C M L Page-Christiaens, Peter G Scheffer, C Ellen van der Schoot
OBJECTIVE:  To determine the accuracy of non-invasive fetal testing for the RHD gene in week 27 of pregnancy as part of an antenatal screening programme to restrict anti-D immunoglobulin use to women carrying a child positive for RHD DESIGN:  Prospectively monitoring of fetal RHD testing accuracy compared with serological cord blood typing on introduction of the test. Fetal RHD testing was performed with a duplex real time quantitative polymerase chain reaction, with cell-free fetal DNA isolated from 1 mL of maternal plasma The study period was between 4 July 2011 and 7 October 2012...
November 7, 2016: BMJ: British Medical Journal
https://www.readbyqxmd.com/read/27816772/biochemical-and-functional-characterization-of-glycosaminoglycans-released-from-degranulating-rat-peritoneal-mast-cells-insights-into-the-physiological-role-of-endogenous-heparin
#9
Rebecca Lever, Amir Smailbegovic, Yanira Riffo-Vasquez, Elaine Gray, John Hogwood, Stephen M Francis, Neville V Richardson, Clive P Page, Barbara Mulloy
The properties of commercially prepared heparin as an anticoagulant and antithrombotic agent in medicine are better understood than is the physiological role of heparin in its native form, where it is uniquely found in the secretory granules of mast cells. In the present study we have isolated and characterised the glycosaminoglycans (GAGs) released from degranulating rat peritoneal mast cells. Analysis of the GAGs by NMR spectroscopy showed the presence of both heparin and the galactosaminoglycan dermatan sulphate; heparinase digestion profiles and measurements of anticoagulant activity were consistent with this finding...
November 2, 2016: Pulmonary Pharmacology & Therapeutics
https://www.readbyqxmd.com/read/27809255/mono-pegylation-of-alpha-mmc-and-map30-from-momordica-charantia-l-production-identification-and-anti-tumor-activity
#10
Yun Sun, Fenghui Sun, Jianlong Li, Minlu Wu, Xiang Fan, Yanfa Meng, Yao Meng
PEGylation is a well-established and effective strategy to decrease immunogenicity, which can increase the stability and in vivo half-life time. However, the generation of multi-site modified products is inevitable due to the lysine chemistry, which will bring difficulties in subsequent research, such as purification and quantification. Site-specific modification by mPEG-succinimidyl carbonate (mPEG-SC) is a widely used method for N-terminal conjugation. In this study, we used it for site-directed modification on two ribosome-inactivating proteins (RIPs), alpha-momorcharin (α-MMC) and momordica anti-HIV protein (MAP30), from Momordica charantia L...
October 31, 2016: Molecules: a Journal of Synthetic Chemistry and Natural Product Chemistry
https://www.readbyqxmd.com/read/27805225/phosphorothioate-anti-sense-oligonucleotides-the-kinetics-and-mechanism-of-the-sulfurisation-of-phosphites-by-phenylacetyl-disulfide-pads
#11
James L Scotson, Benjamin I Andrews, Andrew P Laws, Michael I Page
In the pharmaceutical industry the sulfurisation of nucleotide-phosphites to produce more biologically stable thiophosphates is often achieved using 'aged' solutions of phenylacetyl disulfide (PADS) which consist of a mixture of polysulfides that are more efficient sulfur transfer reagents. However, both 'fresh' and 'aged' solutions of PADS are capable of the sulfurisation of phosphites. The rates of both processes in acetonitrile are first order in sulfurising agent, phosphite and a pyridine base, although with 'aged' PADS the rate becomes independent of base at high concentrations...
November 2, 2016: Organic & Biomolecular Chemistry
https://www.readbyqxmd.com/read/27798666/a-novel-physiological-glycosaminoglycan-deficient-splice-variant-of-neuropilin-1-is-anti-tumorigenic-in-vitro-and-in-vivo
#12
Céline Hendricks, Johanne Dubail, Laura Brohée, Yves Delforge, Alain Colige, Christophe Deroanne
Neuropilin-1 (NRP1) is a transmembrane protein acting as a co-receptor for several growth factors and interacting with other proteins such as integrins and plexins/semaphorins. It is involved in axonal development, angiogenesis and cancer progression. Its primary mRNA is subjected to alternative splicing mechanisms generating different isoforms, some of which lack the transmembrane domain and display antagonist properties to NRP1 full size (FS). NRP1 is further post-translationally modified by the addition of glycosaminoglycans (GAG) side chains through an O-glycosylation site at serine612...
2016: PloS One
https://www.readbyqxmd.com/read/27797005/purification-of-antibacterial-chapk-protein-using-a-self-cleaving-fusion-tag-and-its-activity-against-methicillin-resistant-staphylococcus-aureus
#13
Elahe Seyed Hosseini, Rezvan Moniri, Yasaman Dasteh Goli, Hamed Haddad Kashani
Therapeutic LysK-CHAP is a potent anti-staphylococcal protein that could be utilized as an antibiotic substitute. Intein-mediated protein purification is a reasonable and cost-effective method that is most recently used for recombinant therapeutic protein production. Intein (INT) is the internal parts of the protein that can be separated from the immature protein during protein splicing process. This sequence requires no specific enzyme or cofactor for separation. INT sequence and their characteristic of self-cleavage by thiol induction, temperature, and pH changes are used for protein purification...
October 28, 2016: Probiotics and Antimicrobial Proteins
https://www.readbyqxmd.com/read/27795879/gene-cloning-expression-and-polyclonal-antibody-preparation-of-rab3a-for-protein-interaction-analysis
#14
Xia Tang, Jia Chen, Ying Wang, Xianchun Wang
BACKGROUND: Rab3A is a GTP-binding protein and plays critical roles in the regulation of synaptic vesicle exocytosis. Up to date, how Rab3A participates in such a regulatory process is not completely clear. RESULTS: In this report the Rab3A gene from Rattus norvegicus was cloned and heterologously expressed in E. coli using pCold-TF expression vector with folding capacity. Due to the presence of His-tag sequence on the N-terminal side, Rab3A fusion protein was purified to greater than 95 % purity with a single Ni-affinity purification step...
2016: SpringerPlus
https://www.readbyqxmd.com/read/27787715/bifunctional-drugs-for-the-treatment-of-respiratory-diseases
#15
Clive Page, Mario Cazzola
Over the last decade, there has been a steady increase in the use of fixed dose combinations for the treatment of a range of diseases, including cancer, AIDS, tuberculosis and other infectious diseases. It is now evident that patients with asthma or chronic obstructive pulmonary disease (COPD) can also benefit from the use of fixed dose combinations, including combinations of a long-acting β2-agonist (LABA) and an inhaled corticosteroid (ICS), and combinations of LABAs and long-acting muscarinic receptor antagonists (LAMAs)...
October 28, 2016: Handbook of Experimental Pharmacology
https://www.readbyqxmd.com/read/27785602/induction-of-specific-humoral-immune-response-in-mice-immunized-with-rop18-nanospheres-from-toxoplasma-gondii
#16
Habibun Nabi, Imran Rashid, Nisar Ahmad, Aneela Durrani, Haroon Akbar, Saher Islam, Amna Arshad Bajwa, Wasim Shehzad, Kamran Ashraf, Nyla Imran
Toxoplasmosis is one of the most common zoonotic protozoal diseases. Recent advances in biotechnology have produced recombinant protein, which are immunogenic, and progress in nano-pharmaceutics has generated encapsulated protein in nanospheres, which are suitable for vaccine delivery. DNA was extracted from Toxoplasma gondii oocysts and was confirmed through nested PCR and sequencing. The 1665 bp of ROP18 was cloned into the easy vector system: pGEM-T by the T-A cloning method. DH5α bacteria were transfected with pGEM-ROP18...
October 27, 2016: Parasitology Research
https://www.readbyqxmd.com/read/27782834/enhanced-stimulation-of-anti-breast-cancer-t-cells-responses-by-dendritic-cells-loaded-with-poly-lactic-co-glycolic-acid-plga-nanoparticle-encapsulated-tumor-antigens
#17
Soodabeh Iranpour, Vahid Nejati, Nowruz Delirezh, Pouria Biparva, Sadegh Shirian
BACKGROUND: Developing safe and effective cancer vaccine formulations is a primary focus in the field of cancer immunotherapy. Dendritic cells (DC) are currently employed as cellular vaccine in clinical trials of tumor immunotherapy. Recognizing the critical role of DCs in initiating anti-tumor immunity has resulted in the development of several strategies that target vaccine antigens to DCs to trigger anti-tumor T cell responses. To increase the efficiency of antigen delivery systems for anti-tumor vaccines, encapsulation of tumor-associated antigens in polymer nanoparticles (NPs) has been established...
October 26, 2016: Journal of Experimental & Clinical Cancer Research: CR
https://www.readbyqxmd.com/read/27774953/-preparation-and-identification-of-rabbit-anti-akr1b10-polyclonal-antibody
#18
Jian Hu, Qingmei Wang, Li Huang, Yuanqing Zeng, Zheng Hu, Dixian Luo
Objective To prepare rabbit anti-aldo-keto reductase family 1 member B10 (AKR1B10) polyclonal antibody and identify its specificity. Methods AKR1B10 cDNA was amplified by reverse transcription PCR (RT-PCR) and inserted into prokaryotic expression vector pET-15b to form recombinant plasmid pET-15b-AKR1B10. The recombinant plasmid pET-15b-AKR1B10 was transformed into E.coli DH5α. Isopropylthio-β-D-galactoside (IPTG) was used to induce the expression of the recombinant protein His-tagged AKR1B10 in E.coli DH5α...
November 2016: Xi Bao Yu Fen Zi Mian Yi Xue za Zhi, Chinese Journal of Cellular and Molecular Immunology
https://www.readbyqxmd.com/read/27774952/-preparation-and-biological-activity-of-anti-human-c-mesenchymal-epithelial-transition-factor-c-met-monovalent-antibody
#19
Jia Guo, Ming Jiang, Lingjing Jin, Yanxin Yin, Hui Sun, Lihua Yu, Yuting Mao, Jianmin Fang
Objective To construct lentiviral vectors for the expression of monovalent antibody against human c-mesenchymal epithelial transition factor (c-Met) using anti-c-Met chimeric antibody ch3E1D7 plasmid, and test the affinity and neutralizing ability of the purified monovalent antibody in transfected HEK293T cells. Methods The anti-c-Met monovalent antibody was designed, namely mono3E1D7. Three different lentiviral expression vectors of the monovalent antibody were then constructed using genetic engineering technology...
November 2016: Xi Bao Yu Fen Zi Mian Yi Xue za Zhi, Chinese Journal of Cellular and Molecular Immunology
https://www.readbyqxmd.com/read/27765678/effect-of-anticoagulants-on-the-protein-corona-induced-reduced-drug-carrier-adhesion-efficiency-in-human-blood-flows
#20
Daniel J Sobczynski, Omolola Eniola-Adefeso
: Plasma proteins rapidly coat the surfaces of particulate drug carriers to form a protein corona upon their injection into the bloodstream. The high presence of immunoglobulins in the corona formed on poly(lactic-co-glycolic acid) (PLGA) vascular-targeted carrier (VTC) surfaces was recently shown to negatively impact their adhesion to activated endothelial cells (aECs) in vitro. Here, we characterized the influence of anticoagulants, or their absence, on the binding efficiency of VTCs of various materials via modulation of their protein corona...
October 17, 2016: Acta Biomaterialia
keyword
keyword
14225
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"