keyword
MENU ▼
Read by QxMD icon Read
search

Precision 2.0

keyword
https://www.readbyqxmd.com/read/28092852/graphene-oxide-adsorbent-based-dispersive-solid-phase-extraction-coupled-with-multi-pretreatment-clean-up-for-analysis-of-trace-aflatoxins-in-traditional-proprietary-chinese-medicines
#1
Congcong Ran, Dan Chen, Haiyan Ma, Ye Jiang
Graphene oxide (GO)-based dispersive solid phase extraction (D-SPE) method combined with multi-step preparation has been proposed for the evaluation of trace aflatoxins in proprietary Chinese medicines (PCM). After being extracted by methanol, the sample was purified based on multi-step preparation, including dehydration with MgSO4/NaCl and cleanup with neutral alumina. Then GO was used as an adsorbent in D-SPE method for further preconcentration of aflatoxins prior to high performance liquid chromatography-fluorescence detection...
January 3, 2017: Journal of Chromatography. B, Analytical Technologies in the Biomedical and Life Sciences
https://www.readbyqxmd.com/read/28092739/an-emg-driven-biomechanical-model-of-the-canine-cervical-spine
#2
M Alizadeh, G G Knapik, J S Dufour, C Zindl, M J Allen, J Bertran, N Fitzpatrick, W S Marras
Due to the frequency of cervical spine injuries in canines, the purpose of this effort was to develop an EMG-driven dynamic model of the canine cervical spine to assess a biomechanical understanding that enables one to investigate the risk of neck disorders. A canine subject was recruited in this investigation in order to collect subject specific data. Reflective markers and a motion capture system were used for kinematic measurement; surface electrodes were used to record electromyography signals, and with the aid of force plate kinetics were recorded...
December 26, 2016: Journal of Electromyography and Kinesiology
https://www.readbyqxmd.com/read/28092638/mr-elastography-to-measure-the-effects-of-cancer-and-pathology-fixation-on-prostate-biomechanics-and-comparison-with-t-1-t-2-and-adc
#3
Deirdre M McGrath, Jenny Lee, Warren D Foltz, Navid Samavati, Theo van der Kwast, Michael A S Jewett, Peter Chung, Cynthia Ménard, Kristy K Brock
MRI is under evaluation for image-guided intervention for prostate cancer. The sensitivity and specificity of MRI parameters is determined via correlation with the gold-standard of histopathology. Whole-mount histopathology of prostatectomy specimens can be digitally registered to in vivo imaging for correlation. When biomechanical-based deformable registration is employed to account for deformation during histopathology processing, the ex vivo biomechanical properties are required. However, these properties are altered by pathology fixation, and vary with disease...
February 7, 2017: Physics in Medicine and Biology
https://www.readbyqxmd.com/read/28092557/single-image-super-resolution-using-global-regression-based-on-multiple-local-linear-mappings
#4
Jae-Seok Choi, Munchurl Kim
Super-resolution (SR) has become more vital, because of its capability to generate high-quality ultra-high definition (UHD) high-resolution (HR) images from low-resolution (LR) input images. Conventional SR methods entail high computational complexity, which makes them difficult to be implemented for up-scaling of full-high-definition (FHD) input images into UHD-resolution images. Nevertheless, our previous super-interpolation (SI) method showed a good compromise between PSNR performances and computational complexity...
January 10, 2017: IEEE Transactions on Image Processing: a Publication of the IEEE Signal Processing Society
https://www.readbyqxmd.com/read/28092428/reproducibility-of-clinical-events-adjudications-in-a-trial-of-venous-thromboembolism-prevention
#5
P Girard, A Penaloza, F Parent, B Gable, O Sanchez, P Durieux, P Hausfater, S Dambrine, G Meyer, P-M Roy
BACKGROUND: When clinical trials use clinical endpoints, establishing independent Clinical Events Committees (CEC) is recommended to homogenize the interpretation of investigators data. However, the reproducibility of CEC adjudications is almost unexplored. OBJECTIVES: To assess the reproducibility of CEC adjudications in a trial of venous thromboembolism (VTE) prevention. METHODS: The PREVENU study, a multicenter trial of VTE prevention, included 15,351 hospitalized medical patients...
January 16, 2017: Journal of Thrombosis and Haemostasis: JTH
https://www.readbyqxmd.com/read/28091717/bar-adsorptive-microextraction-technique-application-for-the-determination-of-pharmaceuticals-in-real-matrices
#6
Carlos Almeida, Samir M Ahmad, José Manuel F Nogueira
In the present work, bar adsorptive microextraction using miniaturized devices (7.5 × 3.0 mm) coated with suitable sorbent phases, combined with microliquid desorption (100 μL) followed by high-performance liquid chromatography with diode array detection (BAμE-μLD/HPLC-DAD), is proposed for the determination of trace level of six pharmaceuticals (furosemide, mebeverine, ketoprofen, naproxen, diclofenac and mefenamic acid) in environmental water and urine matrices. By comparing ten distinct sorbent materials (five polymeric and five activated carbons), the polymer P5 proved to be the most suitable to achieve the best selectivity and efficiency...
January 16, 2017: Analytical and Bioanalytical Chemistry
https://www.readbyqxmd.com/read/28091395/a-novel-onset-detection-technique-for-brain-computer-interfaces-using-sound-production-related-cognitive-tasks-in-simulated-online-system
#7
YoungJae Song, Francisco Sepulveda
OBJECTIVE: Self-paced EEG-based BCIs (SP-BCIs) have traditionally been avoided due to two sources of uncertainty: (1) precisely when an intentional command is sent by the brain, i.e., the command onset detection problem, and (2) how different the intentional command is when compared to non-specific (or idle) states. Performance evaluation is also a problem and there are no suitable standard metrics available. In this paper we attempted to tackle these issues. APPROACH: Self-paced covert sound-production cognitive tasks (i...
February 2017: Journal of Neural Engineering
https://www.readbyqxmd.com/read/28090656/real-time-monitoring-of-tissue-displacement-and-temperature-changes-during-mr-guided-high-intensity-focused-ultrasound
#8
Pierre Bour, Fabrice Marquet, Valéry Ozenne, Solenn Toupin, Erik Dumont, Jean-François Aubry, Matthieu Lepetit-Coiffe, Bruno Quesson
PURPOSE: The therapy endpoint most commonly used in MR-guided high intensity focused ultrasound is the thermal dose. Although namely correlated with nonviable tissue, it does not account for changes in mechanical properties of tissue during ablation. This study presents a new acquisition sequence for multislice, subsecond and simultaneous imaging of tissue temperature and displacement during ablation. METHODS: A single-shot echo planar imaging sequence was implemented using a pair of motion-encoding gradients, with alternated polarities...
January 16, 2017: Magnetic Resonance in Medicine: Official Journal of the Society of Magnetic Resonance in Medicine
https://www.readbyqxmd.com/read/28089894/determining-the-cleavage-site-for-the-mature-antimicrobial-peptide-of-nile-tilapia-%C3%AE-defensin-using-2d-electrophoresis-western-blot-and-mass-spectrometry-analysis
#9
Chin-I Chang, Li-Hao Chen, Yeh-Fang Hu, Chia-Che Wu, Jyh-Ming Tsai
Several proteomic techniques were used to determine the cleavage site of the mature antimicrobial peptide of Nile tilapia β-defensin. The computer-predicted Nile tilapia β-defensin ((25)ASFPWSCLSLSGVCRKVCLPTELFFGPLGCGKGSLCCVSHFL(66)) composed of 42 amino acids was chemically synthesized and prepared to produce an antibody for Western blotting. Total proteins from the skin of the Nile tilapia were separated on two-dimensional electrophoresis, and the spot of Nile tilapia β-defensin was recognized using Western blot analysis...
January 9, 2017: Fish & Shellfish Immunology
https://www.readbyqxmd.com/read/28089878/pre-transplant-absolute-lymphocyte-counts-impact-the-pharmacokinetics-of-alemtuzumab
#10
Rebecca Marsh, Tsuyoshi Fukuda, Chie Emoto, Lisa Neumeier, Pooja Khandelwal, Sharat Chandra, Ashley Teusink, Alexander Vinks, Parinda A Mehta
Alemtuzumab is frequently used as part of reduced intensity conditioning (RIC) regimens for the allogeneic hematopoietic cell transplantation (HCT) of pediatric patients with non-malignant diseases. We have previously suggested an optimal Day 0 targeted range of alemtuzumab, but there are no pediatric data regarding the pharmacokinetics (PK) of subcutaneous alemtuzumab to guide precision dosing trials. The goal of this study was to prospectively characterize alemtuzumab PK and to explore absolute lymphocyte count (ALC) as a predictor of interindividual variability...
January 12, 2017: Biology of Blood and Marrow Transplantation
https://www.readbyqxmd.com/read/28089477/bioimpedance-and-fluid-status-in-children-and-adolescents-treated-with-dialysis
#11
Gregorio P Milani, Jaap W Groothoff, Federica A Vianello, Emilio F Fossali, Fabio Paglialonga, Alberto Edefonti, Carlo Agostoni, Dario Consonni, Dewi van Harskamp, Johannes B van Goudoever, Henk Schierbeek, Michiel J S Oosterveld
BACKGROUND: Assessment of hydration status in patients with chronic kidney failure treated by dialysis is crucial for clinical management decisions. Dilution techniques are considered the gold standard for measurement of body fluid volumes, but they are unfit for day-to-day care. Multifrequency bioimpedance has been shown to be of help in clinical practice in adults and its use in children and adolescents has been advocated. We investigated whether application of multifrequency bioimpedance is appropriate for total-body water (TBW) and extracellular water (ECW) measurement in children and adolescents on dialysis therapy...
January 12, 2017: American Journal of Kidney Diseases: the Official Journal of the National Kidney Foundation
https://www.readbyqxmd.com/read/28089455/comparison-of-transcatheter-aortic-valve-implantation-with-the-newest-generation-sapien-3-vs-direct-flow-medical-valve-in-a-single-center-cohort
#12
Eberhard Schulz, Alexander Jabs, Alexander Tamm, Patrick Herz, Andreas Schulz, Tommaso Gori, Stephan von Bardeleben, Walter Kasper-König, Ulrich Hink, Christian-Friedrich Vahl, Thomas Münzel
BACKGROUND: The latest generation transcatheter heart valves including Edwards Sapien 3 (ES3) and Direct Flow Medical (DFM) were designed to allow precise implantation at the intended position and to minimize prosthesis dysfunction as well as procedural complications. Our aim was to compare short-term functional and clinical outcomes of these 2 transcatheter aortic valve systems. METHODS: Of 174 patients undergoing transfemoral transcatheter aortic valve implantation (TAVI) at our institution between August 2013 and June 2015, 113 were treated with ES3 and 61 with DFM...
January 7, 2017: International Journal of Cardiology
https://www.readbyqxmd.com/read/28088764/prevalence-and-long-term-prognosis-of-patients-with-narrower-than-normal-qrs-complexes
#13
Philippe Maury, Elodie Lematte, Nicolas Derval, Anne Rollin, Vanina Bongard, Alexandre Duparc, Pierre Mondoly, Christelle Cardin, Marie Sadron, Michel Galinier, Didier Carrié, Meleze Hocini, Arnaud Denis, Pierre Jaïs, Frederic Sacher, Michel Haïssaguerre, Jean Ferrieres, Jean Bernard Ruidavets
AIMS: Very narrow QRS have been reported in sudden death survivors but prevalence and prognosis role of narrow QRS is unknown. METHODS AND RESULTS: 546 healthy men between 50 and 60 years (group 1) and 373 similar patients with coronary artery disease (368 men, group 2) underwent signal averaged ECG (SA-ECG) allowing precise measurement of QRS duration. All cause-mortality was determined after 18 ± 3 years follow-up. Mean QRS duration was 97 ± 13 ms in group 1 and 103 ± 16 ms in group 2...
January 14, 2017: Europace: European Pacing, Arrhythmias, and Cardiac Electrophysiology
https://www.readbyqxmd.com/read/28088663/development-and-validation-of-a-sensitive-and-fast-uplc-ms-ms-method-for-simultaneous-determination-of-seven-bioactive-compounds-in-rat-plasma-after-oral-administration-of-guizhi-gancao-decoction
#14
Bin Ji, Limeng Zhuo, Bin Yang, Yang Wang, Lin Li, Miao Yu, Yunli Zhao, Zhiguo Yu
Rapid, sensitive, selective and accurate UPLC-MS/MS method was developed and fully validated for simultaneous determination of cinnamaldehyde, cinnamic acid, 2-methoxy cinnamic acid, glycyrrhizic acid, glycyrrhetinic acid, liquiritigenin and isoliquiritin in rat plasma after oral administration of Guizhi-gancao decoction. Plasma samples were processed with a simple protein precipitation technique using acetonitrile, followed by chromatographic separation using a Thermo Hypersil GOLD C18 column. A 11.0min linear gradient elution was used at a flow rate of 0...
January 9, 2017: Journal of Pharmaceutical and Biomedical Analysis
https://www.readbyqxmd.com/read/28088419/hexanal-as-biomarker-for-milk-oxidative-stress-induced-by-copper-ions
#15
Mohammad Asaduzzaman, Franco Biasioli, Maria Stella Cosio, Matteo Schampicchio
Milk flavor varies greatly due to its oxidative stress during storage. Several studies have documented the use of volatile biomarkers for determining milk oxidation, but only a few have focused on the development of inline procedures enabling the monitoring of milk oxidative stress. In this work, oxidative stress was induced in pasteurized milk samples by spiking increasing concentrations of copper ions (from 0 to 32 mg·L(-1)). During storage (4°C), hexanal evolution was monitored by a proton transfer reaction mass spectrometer...
January 11, 2017: Journal of Dairy Science
https://www.readbyqxmd.com/read/28087970/liquid-chromatography-mass-spectrometry-high-resolution-for-the-determination-of-baclofen-and-its-metabolites-in-plasma-application-to-therapeutic-drug-monitoring
#16
Laurence Labat, Antonio Goncalves, Ana Rita Marques, Bénédicte Duretz, Bernard Granger, Xavier Declèves
Baclofen is actually used to manage alcohol dependence. This study describes a simple method using liquid chromatography coupled to high resolution mass spectrometry (LC-HR-MS) developed in plasma samples. This method was optimized to allow quantification of baclofen and determination of metabolic ratio of its metabolites, an oxidative deaminated metabolite of baclofen (M1) and its glucuronide form (M2). The LC-HR-MS method on Exactive® apparatus is a new developed method with all the advantages of the high resolution in full scan mode for the quantification of baclofen and detection of its metabolites in plasma...
January 14, 2017: Biomedical Chromatography: BMC
https://www.readbyqxmd.com/read/28087893/brompheniramine-as-a-novel-probe-for-indirect-uv-detection-and-its-application-for-the-capillary-electrophoresis-of-adamantane-drugs
#17
Pornpan Prapatpong, Brompoj Prutthiwanasan, Nantana Nuchtavorn, Sawanya Buranaphalin, Leena Suntornsuk
Brompheniramine, an antihistamine drug, was employed as a novel UV probe for capillary electrophoresis with indirect UV detection of adamantane drugs (memantine, amantadine, and rimantadine). The probe possesses high molar absorptivity of 24 × 10(3) L/mol cm at 6 mM, which enables the measurement of these non-chromophore analytes without derivatization. The simple background electrolyte (10 mM sodium dihydrogen phosphate (pH 5.0) containing 5 mM brompheniramine and 6 mM β-cyclodextrin) provided the separation of the analytes in a short time (7...
January 14, 2017: Journal of Separation Science
https://www.readbyqxmd.com/read/28087456/phase-i-trial-of-total-marrow-and-lymphoid-irradiation-transplant-conditioning-in-patients-with-relapsed-refractory-acute-leukemia
#18
Anthony Stein, Joycelynne Palmer, Ni-Chun Tsai, Monzr M Al Malki, Ibrahim Aldoss, Haris Ali, Ahmed Aribi, Len Farol, Chatchada Karanes, Samer Khaled, An Liu, Margaret O'Donnell, Pablo Parker, Anna Pawlowska, Vinod Pullarkat, Eric Radany, Joseph Rosenthal, Firoozeh Sahebi, Amandeep Salhotra, James F Sanchez, Tim Schultheiss, Ricardo Spielberger, Sandra H Thomas, David Snyder, Ryotaro Nakamura, Guido Marcucci, Stephen J Forman, Jeffrey Wong
Current conditioning regimens provide insufficient disease control in relapsed/refractory acute leukemia (AL) patients undergoing hematopoietic stem cell transplantation (HSCT) with active disease. Intensification of chemotherapy and/or total body irradiation (TBI) is not feasible because of excessive toxicity. Total marrow and lymphoid irradiation (TMLI) allows for precise delivery and increased intensity treatment via sculpting radiation to sites with high disease burden or high risk for disease involvement, while sparing normal tissue...
January 10, 2017: Biology of Blood and Marrow Transplantation
https://www.readbyqxmd.com/read/28087164/anatomic-study-and-electromyographic-analysis-of-the-teres-minor-muscle
#19
Junichiro Hamada, Akimoto Nimura, Kunio Yoshizaki, Keiichi Akita
BACKGROUND: The teres minor muscle is a focused topic on the treatment of massive rotator cuff tears and reverse total shoulder arthroplasty. Its precise anatomy and function have not been completely investigated. The purposes of this study were to anatomically investigate the muscle and analyze electromyographic (EMG) activities during shoulder motion. METHODS: This anatomic study used 20 shoulders from deceased donors (mean age, 75.0 years). EMG data were recorded from 10 healthy volunteers (mean age, 21...
January 10, 2017: Journal of Shoulder and Elbow Surgery
https://www.readbyqxmd.com/read/28081516/autism-does-not-limit-strategic-thinking-in-the-beauty-contest-game
#20
Peter C Pantelis, Daniel P Kennedy
A popular hypothesis in developmental psychology is that individuals with autism spectrum disorder (ASD) have a specific impairment or developmental delay in their ability to reason about other people's mental processes, especially when this reasoning process is of a higher-order, recursive, or nested variety. One type of interpersonal interaction that involves this sort of complex reasoning about others' minds is an economic game, and because economic games have been extensively modeled in behavioral economics, they provide a unique testbed for a quantitative and precise analysis of cognitive functioning in ASD...
January 9, 2017: Cognition
keyword
keyword
120931
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"