keyword
MENU ▼
Read by QxMD icon Read
search

Gel electrophoresis

keyword
https://www.readbyqxmd.com/read/28102850/japanese-encephalitis-virus-induces-human-neural-stem-progenitor-cell-death-by-elevating-grp78-phb-and-hnrnpc-through-er-stress
#1
Sriparna Mukherjee, Noopur Singh, Nabonita Sengupta, Mahar Fatima, Pankaj Seth, Anita Mahadevan, Susarla Krishna Shankar, Arindam Bhattacharyya, Anirban Basu
Japanese encephalitis virus (JEV), which is a causative agent of sporadic encephalitis, harbours itself inside the neural stem/progenitor cells. It is a well-known fact that JEV infects neural stem/progenitor cells and decreases their proliferation capacity. With mass spectrometry-based quantitative proteomic study, it is possible to reveal the impact of virus on the stem cells at protein level. Our aim was to perceive the stem cell proteomic response upon viral challenge. We performed a two-dimensional gel electrophoresis-based proteomic study of the human neural stem cells (hNS1 cell line) post JEV infection and found that 13 proteins were differentially expressed...
January 19, 2017: Cell Death & Disease
https://www.readbyqxmd.com/read/28102738/optimization-and-partial-characterization-of-intracellular-anticandidal-protein-from-aspergillus-giganteus-mtcc-8408-using-taguchi-doe
#2
Debashis Dutta, Mira Debnath Das
A new intracellular antifungal protein (afp) production with average molecular weight 24.3 kDa and yield of 0.65 ± 0.1 mg/gram dry cell weight (gdcw) of mycelia in submerged fermentation of Aspergillus giganteus MTCC 8408 was optimized. Taguchi's DOE (design of experiment) L27 orthogonal array (OA) was constructed using Qualitek-4 software with 8 most influensive factors namely, culture pH, temperature, slant age, inoculum volume, agitation and KH2PO4. Scanning electron microscopy (SEM) was used to correlate the effect of selected factors on fungal cell morphology and afp production...
January 19, 2017: Bioengineered
https://www.readbyqxmd.com/read/28101273/who-scared-the-cat-a-molecular-crime-scene-investigation-laboratory-exercise
#3
Laura E Ott, Susan D Carson
This introductory laboratory exercise gives first-year life science majors or nonmajors an opportunity to gain knowledge and experience in basic bioinformatics and molecular biology laboratory techniques and analysis in the context of a mock crime scene investigation. In this laboratory, students determine if a human (Lady) or dog (Kona) committed the fictional crime of scaring a cat. Students begin by performing in silico PCR using provided dog- and human-specific PCR primers to determine the sequences to be amplified and predict PCR amplicon sizes...
December 2016: Journal of Microbiology & Biology Education: JMBE
https://www.readbyqxmd.com/read/28099500/genetic-analysis-of-vibrio-parahaemolyticus-o3-k6-strains-that-have-been-isolated-in-mexico-since-1998
#4
Abraham Guerrero, Marcial Leonardo Lizárraga-Partida, Bruno Gómez Gil Rodríguez, Alexei Fedorovish Licea-Navarro, Valeria Jeanette Revilla-Castellanos, Irma Wong-Chang, Ricardo González-Sánchez
Vibrio parahaemolyticus is an important human pathogen that has been isolated worldwide from clinical cases, most of which have been associated with seafood consumption. Environmental and clinical toxigenic strains of V. parahaemolyticus that were isolated in Mexico from 1998 to 2012, including those from the only outbreak that has been reported in this country, were characterized genetically to assess the presence of the O3:K6 pandemic clone, and their genetic relationship to strains that are related to the pandemic clonal complex (CC3)...
2017: PloS One
https://www.readbyqxmd.com/read/28099089/genotypic-characterization-of-quinolone-resistant-escherichia-coli-isolates-from-retail-food-in-morocco
#5
Kaotar Nayme, Abouddihaj Barguigua, Brahim Bouchrif, Bouchra Karraouan, Fatima El Otmani, Naima Elmdaghri, Khalid Zerouali, Mohammed Timinouni
This study was conducted to assess the retail food as a possible vehicle for antimicrobial resistant, particularly quinolones resistant and pathogenic Escherichia coli. We determined the prevalence and characteristics of nalidixic acid (Nal) resistant E. coli isolates from diverse retail food samples. In all, 70 (28%) of 250 E. coli isolates studied were Nal-resistant E. coli and 91% of these were multi-drug resistant. Plasmid mediated quinolone resistance genes were identified in 32 isolates, including aac(6')-Ib-cr (n = 16), qnrS1 (n = 11) and qnrB19 (n = 7)...
February 2017: Journal of Environmental Science and Health. Part. B, Pesticides, Food Contaminants, and Agricultural Wastes
https://www.readbyqxmd.com/read/28098340/inhibitory-effect-of-blue-light-emitting-diode-on-migration-and-invasion-of-cancer-cells
#6
Phil-Sun Oh, Hyun-Soo Kim, Eun-Mi Kim, Hyosook Hwang, Hyang Hwa Ryu, SeokTae Lim, Myung-Hee Sohn, Hwan-Jeong Jeong
The aim of this study was to determine the effects and molecular mechanism of blue light emitting diode (LED) in tumor cells. A migration and invasion assay for the metastatic behavior of mouse colon cancer CT-26 and human fibrosarcoma HT-1080 cells was performed. Cancer cell migration-related proteins were identified by obtaining a 2-dimensional gel electrophoresis (2-DE) in total cellular protein profile of blue LED-irradiated cancer cells, followed by matrix-assisted laser desorption/ionization-time of flight (MALDI-TOF) analysis of proteins...
January 18, 2017: Journal of Cellular Physiology
https://www.readbyqxmd.com/read/28097910/purification-and-biochemical-characterization-of-a-novel-thermostable-serine-alkaline-protease-from-aeribacillus-pallidus-c10-a-potential-additive-for-detergents
#7
Vildan Yildirim, Mustafa Ozkan Baltaci, Ilknur Ozgencli, Melda Sisecioglu, Ahmet Adiguzel, Gulsah Adiguzel
An extracellular thermostable alkaline serine protease enzyme from Aeribacillus pallidus C10 (GenBank No: KC333049), was purified 4.85 and 17. 32-fold with a yield of 26.9 and 19.56%, respectively, through DE52 anion exchange and Probond affinity chromatography. The molecular mass of the enzyme was determined through sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), with approximately 38.35 kDa. The enzyme exhibited optimum activity at pH 9 and at temperature 60 °C. It was determined that the enzyme had remained stable at the range of pH 7...
December 2017: Journal of Enzyme Inhibition and Medicinal Chemistry
https://www.readbyqxmd.com/read/28097888/bioprocess-enhancement-of-feather-degradation-using-alkaliphilic-microbial-mixture
#8
Y Osman, A Elsayed, A M Mowafy, A A Elrazak, M Fawzy
1. The main aim of this work is to develop a robust method to generate a microbial mixture which can successfully degrade poultry feathers to overcome environmental problems. 2. Four different alkaliphilic microbes were isolated and shown to to degrade poultry feathers. 3. Two of the isolates were phylogenetically identified as Lysinibacillus and the others were identified as Nocardiopsis and Micrococcus. 4. The best microbial co-culture for white and black feather degradation were optimised for pH, temperature and relative population of the isolates to achieve almost 96% of degradation compared to a maximum of 31% when applying each isolate individually...
January 18, 2017: British Poultry Science
https://www.readbyqxmd.com/read/28097424/analysis-of-the-spleen-proteome-of-chickens-infected-with-reticuloendotheliosis-virus
#9
Mei Xue, Yan Zhao, Shunlei Hu, Xingming Shi, Hongyu Cui, Yunfeng Wang
Infection with reticuloendotheliosis virus (REV), a gammaretrovirus in the family Retroviridae, can result in immunosuppression and subsequent increased susceptibility to secondary infections. In the present study, we identified differentially expressed proteins in the spleens of chickens infected with the REV-A HLJ07I strain, using two-dimensional gel electrophoresis on samples from time points coinciding with different phases of the REV life cycle. Differentially expressed proteins were identified using one-dimensional liquid chromatography electrospray ionization tandem mass spectrometry (1D LC ESI MS/MS)...
January 17, 2017: Archives of Virology
https://www.readbyqxmd.com/read/28097170/microsatellite-ssr-amplification-by-pcr-usually-led-to-polymorphic-bands-evidence-which-shows-replication-slippage-occurs-in-extend-or-nascent-dna-strands
#10
Abasalt Hosseinzadeh-Colagar, Mohammad Javad Haghighatnia, Zahra Amiri, Maryam Mohadjerani, Majid Tafrihi
Microsatellites or simple sequence repeats (SSRs) are very effective molecular markers in population genetics, genome mapping, taxonomic study and other large-scale studies. Variation in number of tandem repeats within microsatellite refers to simple sequence length polymorphism (SSLP); but there are a few studies that are showed SSRs replication slippage may be occurred during in vitro amplification which are produced 'stutter products' differing in length from the main products. The purpose of this study is introducing a reliable method to realize SSRs replication slippage...
September 2016: Molecular Biology Research Communications
https://www.readbyqxmd.com/read/28097167/expression-purification-and-kinetic-characterization-of-recombinant-benzoate-dioxygenase-from-rhodococcus-ruber-ukmp-5m
#11
Arezoo Tavakoli, Ainon Hamzah, Amir Rabu
In this study, benzoate dioxygenase from Rhodococcus ruber UKMP-5M was catalyzed by oxidating the benzene ring to catechol and other derivatives. The benzoate dioxygenase (benA gene) from Rhodococcus ruber UKMP-5M was then expressed, purified, characterized, The benA gene was amplified (642 bp), and the product was cloned into a pGEM-T vector. The recombinant plasmid pGEMT-benA was digested by double restriction enzymes BamHI and HindIII to construct plasmid pET28b-benA and was then ligated into Escherichia coli BL21 (DE3)...
September 2016: Molecular Biology Research Communications
https://www.readbyqxmd.com/read/28096849/assessment-of-the-effects-of-extremely-low-frequency-electromagnetic-fields-on-toxoplasma-gondii
#12
Sercin Ozlem-Caliskan, Hatice Ertabaklar, Mehmet Dincer Bilgin, Sema Ertug
BACKGROUND: The effects of extremely low frequency electromagnetic fields (ELF-EMF) on Toxoplasma gondii have not been explained yet. The aim of this study was to assess the possible effects of ELF-EMF on growth, survival time and viability of Toxoplasma gondii. In addition, the life span of Toxoplasma infected animals was investigated. METHODS: Sixty adult male BALB/c mice were used for in vivo and in vivo experiments in Laboratory of Biopyhsics and Parasitology of Medical Faculty, Adnan Menderes University, Turkey, in 2010...
April 2016: Iranian Journal of Parasitology
https://www.readbyqxmd.com/read/28094255/specific-and-sensitive-isothermal-electrochemical-biosensor-for-plant-pathogen-dna-detection-with-colloidal-gold-nanoparticles-as-probes
#13
Han Yih Lau, Haoqi Wu, Eugene J H Wee, Matt Trau, Yuling Wang, Jose R Botella
Developing quick and sensitive molecular diagnostics for plant pathogen detection is challenging. Herein, a nanoparticle based electrochemical biosensor was developed for rapid and sensitive detection of plant pathogen DNA on disposable screen-printed carbon electrodes. This 60 min assay relied on the rapid isothermal amplification of target pathogen DNA sequences by recombinase polymerase amplification (RPA) followed by gold nanoparticle-based electrochemical assessment with differential pulse voltammetry (DPV)...
January 17, 2017: Scientific Reports
https://www.readbyqxmd.com/read/28093116/captive-and-free-living-urban-pigeons-columba-livia-from-brazil-as-carriers-of-multidrug-resistant-pathogenic-escherichia-coli
#14
Clarissa A Borges, Renato P Maluta, Lívia G Beraldo, Marita V Cardozo, Elisabete A L Guastalli, Subhashinie Kariyawasam, Chitrita DebRoy, Fernando A Ávila
Thirty Escherichia coli isolates from captive and free-living pigeons in Brazil were characterised. Virulence-associated genes identified in pigeons included those which occur relatively frequently in avian pathogenic E. coli (APEC) from commercial poultry worldwide. Eleven of 30 E. coli isolates from pigeons, belonging mainly to B1 and B2 phylogenetic groups, had high or intermediate pathogenicity for 1-day-old chicks. The frequency of multi-drug resistant (MDR) E. coli in captive pigeons was relatively high and included one isolate positive for the extended-spectrum β-lactamase (ESBL) gene blaCTX-M-8...
January 2017: Veterinary Journal
https://www.readbyqxmd.com/read/28093073/application-of-meta-omics-techniques-to-understand-greenhouse-gas-emissions-originating-from-ruminal-metabolism
#15
REVIEW
Robert J Wallace, Timothy J Snelling, Christine A McCartney, Ilma Tapio, Francesco Strozzi
Methane emissions from ruminal fermentation contribute significantly to total anthropological greenhouse gas (GHG) emissions. New meta-omics technologies are beginning to revolutionise our understanding of the rumen microbial community structure, metabolic potential and metabolic activity. Here we explore these developments in relation to GHG emissions. Microbial rumen community analyses based on small subunit ribosomal RNA sequence analysis are not yet predictive of methane emissions from individual animals or treatments...
January 16, 2017: Genetics, Selection, Evolution: GSE
https://www.readbyqxmd.com/read/28092605/molecular-diversity-of-clostridium-botulinum-and-phenotypically-similar-strains
#16
T Grenda, E Kukier, Z Sieradzki, M Goldsztejn, K Kwiatek
This study was undertaken to examine phenotypic and genetic features of strains preliminary classified as Clostridium botulinum species. The phenotypic characteristics were assessed with different culture media and biochemical tests. The genetic characterization included detection of botulinum toxin genes by PCR and macrorestriction analysis with SmaI, XhoI and SacII by PFGE (Pulsed-field Gel Electrophoresis). Despite similar biochemical properties of all analysed strains, only 47% of them contained genes determining toxicity specific to C...
December 1, 2016: Polish Journal of Veterinary Sciences
https://www.readbyqxmd.com/read/28089911/atypical-composition-and-structure-of-the-mitochondrial-dimeric-atp-synthase-from-euglena-gracilis
#17
K N Sathish Yadav, Héctor V Miranda-Astudillo, Lilia Colina-Tenorio, Fabrice Bouillenne, Hervé Degand, Pierre Morsomme, Diego González-Halphen, Egbert J Boekema, Pierre Cardol
Mitochondrial respiratory-chain complexes from Euglenozoa comprise classical subunits described in other eukaryotes (i.e. mammals and fungi) and subunits that are restricted to Euglenozoa (e.g. Euglena gracilis and Trypanosoma brucei). Here we studied the mitochondrial F1FO-ATP synthase (or Complex V) from the photosynthetic eukaryote E. gracilis in detail. The enzyme was purified by a two-step chromatographic procedure and its subunit composition was resolved by a three-dimensional gel electrophoresis (BN/SDS/SDS)...
January 12, 2017: Biochimica et Biophysica Acta
https://www.readbyqxmd.com/read/28089894/determining-the-cleavage-site-for-the-mature-antimicrobial-peptide-of-nile-tilapia-%C3%AE-defensin-using-2d-electrophoresis-western-blot-and-mass-spectrometry-analysis
#18
Chin-I Chang, Li-Hao Chen, Yeh-Fang Hu, Chia-Che Wu, Jyh-Ming Tsai
Several proteomic techniques were used to determine the cleavage site of the mature antimicrobial peptide of Nile tilapia β-defensin. The computer-predicted Nile tilapia β-defensin ((25)ASFPWSCLSLSGVCRKVCLPTELFFGPLGCGKGSLCCVSHFL(66)) composed of 42 amino acids was chemically synthesized and prepared to produce an antibody for Western blotting. Total proteins from the skin of the Nile tilapia were separated on two-dimensional electrophoresis, and the spot of Nile tilapia β-defensin was recognized using Western blot analysis...
January 9, 2017: Fish & Shellfish Immunology
https://www.readbyqxmd.com/read/28088252/quantification-of-whey-protein-content-in-infant-formulas-by-sds-cge
#19
Ping Feng, Christophe Fuerer, Adrienne McMahon
Protein separation by SDS-CGE (Sodium Dodecyl Sulfate - Capillary Gel Electrophoresis) followed by UV absorption at 220nm allows quantification of major proteins in raw milk. In processed dairy samples such as skim milk powder and infant formulas, signals from individual proteins are less resolved, but caseins still migrate as one family between two groups of whey proteins. In the first group, α-Lactalbumin and β-Lactoglobulin migrate as two distinct peaks. Lactosylated adducts show delayed migration times and interfere with peak separation, but both native and modified forms, as well as other low molecular weight whey proteins, still elute before the caseins...
November 18, 2016: Journal of AOAC International
https://www.readbyqxmd.com/read/28087803/epiphytic-planctomycetes-communities-associated-with-three-main-groups-of-macroalgae
#20
Joana Bondoso, Filipa Godoy-Vitorino, Vanessa Balagué, Josep M Gasol, Jens Harder, Olga Maria Lage
Planctomycetes, a unique group of widespread and understudied bacteria, are known to be associated with macroalgae. The temporal dynamics and the host-specific association of planctomycetal communities on Fucus spiralis, Ulva sp. and Chondrus crispus from two locations in the North Coast of Portugal were assessed both by denaturing gradient gel electrophoresis (DGGE) with group-specific primers and 16S rDNA amplicon libraries. The epiphytic planctomycetal communities showed a significant association with the host macroalgal species independently of the geographical location and the season...
January 12, 2017: FEMS Microbiology Ecology
keyword
keyword
116785
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"