keyword
MENU ▼
Read by QxMD icon Read
search

Lina

keyword
https://www.readbyqxmd.com/read/29151152/a-maize-inbred-exhibits-resistance-against-western-corn-rootwoorm-diabrotica-virgifera-virgifera
#1
Lina Castano-Duque, Kenneth W Loades, John F Tooker, Kathleen M Brown, W Paul Williams, Dawn S Luthe
Insect resistance against root herbivores like the western corn rootworm (WCR, Diabrotica virgifera virgifera) is not well understood in non-transgenic maize. We studied the responses of two American maize inbreds, Mp708 and Tx601, to WCR infestation using biomechanical, molecular, biochemical analyses, and laser ablation tomography. Previous studies performed on several inbreds indicated that these two maize genotypes differed in resistance to pests including fall armyworm (Spodoptera frugiperda) and WCR. Our data confirmed that Mp708 shows resistance against WCR, and demonstrates that the resistance mechanism is based in a multi-trait phenotype that includes increased resistance to cutting in nodal roots, stable root growth during insect infestation, constitutive and induced expression of known herbivore-defense genes, including ribosomal inhibitor protein 2 (rip2), terpene synthase 23 (tps23) and maize insect resistance cysteine protease-1 (mir1), as well high constitutive levels of jasmonic acid and production of (E)-β-caryophyllene...
November 18, 2017: Journal of Chemical Ecology
https://www.readbyqxmd.com/read/29150610/implications-of-improved-representations-of-plant-respiration-in-a-changing-climate
#2
Chris Huntingford, Owen K Atkin, Alberto Martinez-de la Torre, Lina M Mercado, Mary A Heskel, Anna B Harper, Keith J Bloomfield, Odhran S O'Sullivan, Peter B Reich, Kirk R Wythers, Ethan E Butler, Ming Chen, Kevin L Griffin, Patrick Meir, Mark G Tjoelker, Matthew H Turnbull, Stephen Sitch, Andy Wiltshire, Yadvinder Malhi
Land-atmosphere exchanges influence atmospheric CO2. Emphasis has been on describing photosynthetic CO2 uptake, but less on respiration losses. New global datasets describe upper canopy dark respiration (R d) and temperature dependencies. This allows characterisation of baseline R d, instantaneous temperature responses and longer-term thermal acclimation effects. Here we show the global implications of these parameterisations with a global gridded land model. This model aggregates R d to whole-plant respiration R p, driven with meteorological forcings spanning uncertainty across climate change models...
November 17, 2017: Nature Communications
https://www.readbyqxmd.com/read/29150562/the-role-of-mhc-e-in-t-cell-immunity-is-conserved-among-humans-rhesus-macaques-and-cynomolgus-macaques
#3
Helen L Wu, Roger W Wiseman, Colette M Hughes, Gabriela M Webb, Shaheed A Abdulhaqq, Benjamin N Bimber, Katherine B Hammond, Jason S Reed, Lina Gao, Benjamin J Burwitz, Justin M Greene, Fidel Ferrer, Alfred W Legasse, Michael K Axthelm, Byung S Park, Simon Brackenridge, Nicholas J Maness, Andrew J McMichael, Louis J Picker, David H O'Connor, Scott G Hansen, Jonah B Sacha
MHC-E is a highly conserved nonclassical MHC class Ib molecule that predominantly binds and presents MHC class Ia leader sequence-derived peptides for NK cell regulation. However, MHC-E also binds pathogen-derived peptide Ags for presentation to CD8(+) T cells. Given this role in adaptive immunity and its highly monomorphic nature in the human population, HLA-E is an attractive target for novel vaccine and immunotherapeutic modalities. Development of HLA-E-targeted therapies will require a physiologically relevant animal model that recapitulates HLA-E-restricted T cell biology...
November 17, 2017: Journal of Immunology: Official Journal of the American Association of Immunologists
https://www.readbyqxmd.com/read/29149209/correction-comparison-of-porous-and-nano-zinc-oxide-for-replacing-high-dose-dietary-regular-zinc-oxide-in-weaning-piglets
#4
Lina Long, Jiashun Chen, Yonggang Zhang, Xiao Liang, Hengjia Ni, Bin Zhang, Yulong Yin
[This corrects the article DOI: 10.1371/journal.pone.0182550.].
2017: PloS One
https://www.readbyqxmd.com/read/29147891/long-term-presence-of-angiotensin-ii-type-1-receptor-autoantibody-reduces-aldosterone-production-by-triggering-ca-2-overload-in-h295r-cells
#5
Jinghui Lei, Suli Zhang, Pengli Wang, Yang Liao, Jingwei Bian, Xiaochen Yin, Ye Wu, Lina Bai, Feng Wang, Xiaoli Yang, Huirong Liu
Preeclamptic women are reported to have inadequate plasma volume expansion coupled with a suppressed secretion of aldosterone; however, the specific mechanism of preeclampsia remains unclear. We demonstrated that the presence of long-term angiotensin II type 1 receptor autoantibody (AT1-AA) reduces aldosterone production by triggering a Ca(2+) overload in H295R cells. AT1-AA was discovered in preeclamptic women and reported to activate AT1R, and consequently elevate intracellular Ca(2+). We found that AT1-AA significantly prolonged the time of intracellular Ca(2+) elevation...
November 16, 2017: Immunologic Research
https://www.readbyqxmd.com/read/29147042/insecticide-treated-nets-and-malaria-prevalence-papua-new-guinea-2008-2014
#6
Manuel W Hetzel, Justin Pulford, Yangta Ura, Sharon Jamea-Maiasa, Anthony Tandrapah, Nandao Tarongka, Lina Lorry, Leanne J Robinson, Ken Lilley, Leo Makita, Peter M Siba, Ivo Mueller
Objective: To investigate changes in malaria prevalence in Papua New Guinea after the distribution of long-lasting Insecticide-treated nets, starting in 2004, and the introduction of artemisinin-based combination therapy in 2011. Methods: Two malaria surveys were conducted in 2010-2011 and 2013-2014. They included 77 and 92 randomly selected villages, respectively. In each village, all members of 30 randomly selected households gave blood samples and were assessed for malaria infection by light microscopy...
October 1, 2017: Bulletin of the World Health Organization
https://www.readbyqxmd.com/read/29146721/development-of-a-function-blocking-antibody-against-fibulin-3-as-targeted-reagent-for-glioblastoma
#7
Mohan Sobhana Nandhu, Prajna Behera, Vivek Bhaskaran, Sharon L Longo, Lina M Barrera-Arenas, Sadhak Sengupta, Diego J Rodriguez-Gil, E Antonio Chiocca, Mariano S Viapiano
PURPOSE: We sought a novel approach against glioblastomas (GBM) focused on targeting signaling molecules localized in the tumor extracellular matrix (ECM). We investigated fibulin-3, a glycoprotein that forms the ECM scaffold of GBMs and promotes tumor progression by driving Notch and NF-kB signaling. EXPERIMENTAL DESIGN: We used deletion constructs to identify a key signaling motif of fibulin-3. A monoclonal antibody (mAb428.2) was generated against this epitope and extensively validated for specific detection of human fibulin-3...
November 16, 2017: Clinical Cancer Research: An Official Journal of the American Association for Cancer Research
https://www.readbyqxmd.com/read/29146527/osthole-attenuates-right-ventricular-remodeling-via-decreased-myocardial-apoptosis-and-inflammation-in-monocrotaline-induced-rats
#8
Yeli Li, Yiqi Li, Fuguo Shi, Lina Wang, Lisheng Li, Danli Yang
Osthole (Ost) is a coumarin that exhibits wide pharmacological effects in the cardiovascular system. However, whether Ost can inhibit apoptosis and inflammation in right ventricle (RV) cardiomyocytes and prevent RV remodeling is not clear. This study was designed to investigate the effect of Ost on RV remodeling and the underlying mechanism. By applying a monocrotaline (MCT)-induced rat model, the effect of Ost on RV remodeling was investigated. Rats were given a single dose of MCT (50mg⁄kg) subcutaneously (s...
November 13, 2017: European Journal of Pharmacology
https://www.readbyqxmd.com/read/29146515/family-history-of-zoster-risk-of-developing-herpes-zoster
#9
Hung Fu Tseng, Margaret Chi, Peggy Hung, Rafael Harpaz, D Scott Schmid, Philip LaRussa, Lina S Sy, Yi Luo, Kimberly Holmquist, Harpreet Takhar, Steven J Jacobsen
BACKGROUND: Studies have investigated a possible association between family history of HZ and the occurrence of HZ. However, the results were inconclusive and susceptible to bias. We evaluated this association in an elderly population. METHODS: The matched case-control study conducted at Kaiser Permanente Southern California in 2012-2015 included 656 incident HZ patients ≥60 whose skin lesion tested positive for varicella zoster virus by polymerase chain reaction...
November 13, 2017: International Journal of Infectious Diseases: IJID
https://www.readbyqxmd.com/read/29146379/lt-adjuvant-modulates-epitope-specificity-and-improves-the-efficacy-of-murine-antibodies-elicited-by-sublingual-vaccination-with-the-n-terminal-domain-of-streptococcus-mutans-p1
#10
Milene Tavares Batista, Ewerton Lucena Ferreira, Gisela de Souza Pereira, Phillip Stafford, Denicar Lina Nascimento Fabris Maeda, Juliana Falcão Rodrigues, L Jeannine Brady, Stephen Albert Johnston, Luís Carlos de Souza Ferreira, Rita de Cássia Café Ferreira
In this study, we evaluated the immunogenicity, protective efficacy and peptide-based immune signatures of antibodies raised in mice after sublingual immunization with a recombinant form of the P1 (aka AgI/II, PAc) adhesin (P139-512) of Streptococcus mutans, a major etiological agent of dental caries. Sublingual administration of P139-512 in combination with the mucosal adjuvant LTK4R (a derivative of heat-labile LT toxin) induced strong and long-lasting systemic and mucosal immune responses. Incorporation of the adjuvant resulted in an enhancement of the anti-adhesive and anti-colonization activity against S...
November 13, 2017: Vaccine
https://www.readbyqxmd.com/read/29145752/association-of-hormonal-contraception-with-suicide-attempts-and-suicides
#11
Charlotte Wessel Skovlund, Lina Steinrud Mørch, Lars Vedel Kessing, Theis Lange, Øjvind Lidegaard
OBJECTIVE: The purpose of this study was to assess the relative risk of suicide attempt and suicide in users of hormonal contraception. METHOD: The authors assessed associations between hormonal contraceptive use and suicide attempt and suicide in a nationwide prospective cohort study of all women in Denmark who had no psychiatric diagnoses, antidepressant use, or hormonal contraceptive use before age 15 and who turned 15 during the study period, which extended from 1996 through 2013...
November 17, 2017: American Journal of Psychiatry
https://www.readbyqxmd.com/read/29145141/characterizing-pollutant-emissions-from-mosquito-repellents-incenses-and-implications-in-risk-assessment-of-human-health
#12
Lina Wang, Xinran Zheng, Svetlana Stevanovic, Zhiyuan Xiang, Jing Liu, Huiwen Shi, Jing Liu, Mingzhou Yu, Chun Zhu
Mosquito-repellent incense is one of the most popular products used for dispelling mosquitos during summer in China. It releases large amounts of particulate and gaseous pollutants which constitute a potential hazard to human health. We conducted chamber experiment to characterize major pollutants from three types of mosquito-repellent incenses, further assessed the size-fractionated deposition in human respiratory system, and evaluated the indoor removing efficiency by fresh air. Results showed that the released pollutant concentrations were greater than permissible levels in regulations in GB3095-2012, as well as suggested by the World Health Organization (WHO)...
October 22, 2017: Chemosphere
https://www.readbyqxmd.com/read/29145027/differential-gene-expression-in-the-intestine-of-sea-cucumber-apostichopus-japonicus-under-low-and-high-salinity-conditions
#13
Libin Zhang, Qiming Feng, Lina Sun, Kui Ding, Da Huo, Yan Fang, Tao Zhang, Hongsheng Yang
Sea cucumber, Apostichopus japonicus is an important species for aquaculture, and its behavior and physiology can change in response to changing salinity conditions. For this reason, it is important to understand the molecular responses of A. japonicus when exposed to ambient changes in salinity. In this study, RNA-Seq provided a general overview of the gene expression profiles in the intestine of A. japonicus exposed to high salinity (SD40), normal salinity (SD30) and low salinity (SD20) environments. Screening for differentially expressed genes (DEGs) using the NOISeq method identified 109, 100, and 89 DEGs based on a fold change of ≥2 and divergence probability ≥0...
November 4, 2017: Comparative Biochemistry and Physiology. Part D, Genomics & Proteomics
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#14
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29144607/eustachian-tube-dysfunction-symptoms-in-patients-treated-in-a-tertiary-rhinology-clinic
#15
Michael J Marino, Lina Chooi Ling, William C Yao, Amber Luong, Martin J Citardi
BACKGROUND: Ear symptoms are common among patients presenting to a rhinology clinic. Validated inventories are available for patient quality-of-life in sinonasal disease and Eustachian tube dysfunction (ETD). This study sought to determine the extent of ETD symptoms, using validated metrics, in a large population of patients presenting to a tertiary rhinology clinic. METHODS: Seven-item Eustachian Tube Dysfunction Questionnaires (ETDQ-7) and 22-item Sino-Nasal Outcome Tests (SNOT-22) were prospectively collected from 492 patients treated in a tertiary rhinology clinic...
November 16, 2017: International Forum of Allergy & Rhinology
https://www.readbyqxmd.com/read/29144503/mait-cells-in-type-1-diabetes-a-good-friend-turned-bad
#16
Lina Petersone, Lucy S K Walker
No abstract text is available yet for this article.
November 16, 2017: Nature Immunology
https://www.readbyqxmd.com/read/29143805/mechanisms-of-acupuncture-therapy-in-ischemic-stroke-rehabilitation-a-literature-review-of-basic-studies
#17
REVIEW
Lina M Chavez, Shiang-Suo Huang, Iona MacDonald, Jaung-Geng Lin, Yu-Chen Lee, Yi-Hung Chen
Acupuncture is recommended by the World Health Organization (WHO) as an alternative and complementary strategy for stroke treatment and for improving stroke care. Clinical trial and meta-analysis findings have demonstrated the efficacy of acupuncture in improving balance function, reducing spasticity, and increasing muscle strength and general well-being post-stroke. The mechanisms underlying the beneficial effects of acupuncture in stroke rehabilitation remain unclear. The aim of this study was to conduct a literature review, summarize the current known mechanisms in ischemic stroke rehabilitation through acupuncture and electroacupuncture (EA) therapy, and to detail the frequently used acupoints implicated in these effects...
October 28, 2017: International Journal of Molecular Sciences
https://www.readbyqxmd.com/read/29143681/economic-evaluation-of-hcv-testing-approaches-in-low-and-middle-income-countries
#18
REVIEW
Jake R Morgan, Maria Servidone, Philippa Easterbrook, Benjamin P Linas
BACKGROUND: Hepatitis C virus (HCV) infection represents a major public health burden with diverse epidemics worldwide, but at present, only a minority of infected persons have been tested and are aware of their diagnosis. The advent of highly effective direct acting antiviral (DAA) therapy, which is becoming available at increasingly lower costs in low and middle income countries (LMICs), represents a major opportunity to expand access to testing and treatment. However, there is uncertainty as to the optimal testing approaches and who to prioritize for testing...
November 1, 2017: BMC Infectious Diseases
https://www.readbyqxmd.com/read/29143170/circumferential-strain-acquired-by-cmr-early-after-acute-myocardial-infarction-adds-incremental-predictive-value-to-late-gadolinium-enhancement-imaging-to-predict-late-myocardial-remodeling-and-subsequent-risk-of-sudden-cardiac-death
#19
Anthony A Holmes, Jorge Romero, Jeffrey M Levsky, Linda B Haramati, Newton Phuong, Leila Rezai-Gharai, Stuart Cohen, Lina Restrepo, Luis Ruiz-Guerrero, John D Fisher, Cynthia C Taub, Luigi Di Biase, Mario J Garcia
PURPOSE: Late adverse myocardial remodeling after acute myocardial infarction (AMI) is strongly associated with sudden cardiac death (SCD). Cardiac magnetic resonance (CMR) performed early after AMI can predict late remodeling and SCD risk with moderate accuracy. This study assessed the ability of CMR-measured circumferential strain (CS) to add incremental predictive information to late gadolinium enhancement (LGE). METHODS: Patients with an AMI and LVEF < 50% were screened for inclusion...
November 15, 2017: Journal of Interventional Cardiac Electrophysiology: An International Journal of Arrhythmias and Pacing
https://www.readbyqxmd.com/read/29141839/patient-health-record-systems-scope-and-functionalities-literature-review-and-future-directions
#20
REVIEW
Lina Bouayad, Anna Ialynytchev, Balaji Padmanabhan
BACKGROUND: A new generation of user-centric information systems is emerging in health care as patient health record (PHR) systems. These systems create a platform supporting the new vision of health services that empowers patients and enables patient-provider communication, with the goal of improving health outcomes and reducing costs. This evolution has generated new sets of data and capabilities, providing opportunities and challenges at the user, system, and industry levels. OBJECTIVE: The objective of our study was to assess PHR data types and functionalities through a review of the literature to inform the health care informatics community, and to provide recommendations for PHR design, research, and practice...
November 15, 2017: Journal of Medical Internet Research
keyword
keyword
11177
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"