keyword
MENU ▼
Read by QxMD icon Read
search

Spectroscopy

keyword
https://www.readbyqxmd.com/read/29145401/anatomically-specific-intratubular-and-interstitial-biominerals-in-the-human-renal-medullo-papillary-complex
#1
Ling Chen, Ryan S Hsi, Feifei Yang, Benjamin A Sherer, Marshall L Stoller, Sunita P Ho
Limited information exists on the anatomically-specific early stage events leading to clinically detectable mineral aggregates in the renal papilla. In this study, quantitative multiscale correlative maps of structural, elemental and biochemical properties of whole medullo-papillary complexes from human kidneys were developed. Correlative maps of properties specific to the uriniferous and vascular tubules using high-resolution X-ray computed tomography, scanning and transmission electron microscopy, energy dispersive X-ray spectroscopy, and immunolocalization of noncollagenous proteins (NCPs) along with their association with anatomy specific biominerals were obtained...
2017: PloS One
https://www.readbyqxmd.com/read/29145203/evaluation-of-mental-disorders-using-proton-magnetic-resonance-spectroscopy-in-dialysis-and-predialysis-patients
#2
Chun-Yun Zhang, Ying Chen, Shan Chen, Xiang-Chuang Kong, Yuan Liu, Chao-Qun You, Cheng Wan, Philip A Bondzie, Hua Su, Chun Zhang, Fang-Fang He
BACKGROUND/AIMS: Psychological complications are prevalent in patients with chronic kidney disease (CKD). This study aimed to investigate mental disorders in stage 4-5 CKD patients, to detect metabolite concentrations in the brain by proton magnetic resonance spectroscopy (1H-MRS) and to compare the effects of different dialysis therapies on mental disorders in end-stage renal disease (ESRD). METHODS: The sample population was made up of predialysis (13), hemodialysis (HD) (13), and peritoneal dialysis (PD) patients (12)...
November 21, 2017: Kidney & Blood Pressure Research
https://www.readbyqxmd.com/read/29145166/revisiting-interhemispheric-imbalance-in-chronic-stroke-a-tdcs-study
#3
Alana B McCambridge, James W Stinear, Winston D Byblow
OBJECTIVE: Chronic stroke patients with moderate-severe motor impairment may have an increased reliance on contralesional vs ipsilesional motor areas to control the paretic arm. We hypothesised that increasing contralesional excitability with anodal transcranial direct current stimulation (a-tDCS) would benefit motor performance in patients with moderate-severe impairment. METHODS: Ten patients with motor impairment at the chronic stage after stroke received a-tDCS, cathodal (c-tDCS) and sham with the target electrode over contralesional motor cortex (M1)...
October 28, 2017: Clinical Neurophysiology: Official Journal of the International Federation of Clinical Neurophysiology
https://www.readbyqxmd.com/read/29145103/gold-chlorophyll-a-hybrid-nanoparticles-and-chlorophyll-a-cetyltrimethylammonium-chloride-self-assembled-suprastructures-as-novel-carriers-for-chlorophyll-a-delivery-in-water-medium-photoactivity-and-photostability
#4
Vito Rizzi, Davide Vurro, Tiziana Placido, Paola Fini, Andrea Petrella, Paola Semeraro, Pinalysa Cosma
The stability of Chlorophyll a in water during prolonged exposure, at room temperature, to a neon lamp has been investigated by means of UV-vis and fluorescence spectroscopies. In addition, the Chlorophyll a (photo)stability evaluation in presence of suitable carriers has been performed in order to investigate its reactivity under the same conditions, for possible and future applications in Antimicrobial Photodynamic Therapy. Cetyltrimethylammonium chloride was chosen to solubilize Chlorophyll a in water. While, cetyltrimethylammonium chloride-capped gold nanoparticles offer a great opportunity because combine the Chlorophyll a action, used as a photosensitizer in Antimicrobial Photodynamic Therapy, with gold nanoparticles effect used in photothermal therapy...
November 9, 2017: Colloids and Surfaces. B, Biointerfaces
https://www.readbyqxmd.com/read/29145096/sulfaguanidine-cocrystals-synthesis-structural-characterization-and-their-antibacterial-and-hemolytic-analysis
#5
Syed Sibte Asghar Abidi, Yasser Azim, Shahper Nazeer Khan, Asad U Khan
Sulfaguanidine (SG), belongs to the class of sulfonamide drug used as an effective antibiotic. In the present work, using crystal engineering approach two novel cocrystals of SG were synthesized (SG-TBA and SG-PT) with thiobarbutaric acid (TBA) and 1,10-phenanthroline (PT), characterized by solid state techniques viz., powder X-ray diffraction (PXRD), fourier transform infrared spectroscopy (FT-IR), differential scanning calorimetry (DSC) and the crystal structures were determined by single crystal X-ray diffraction studies...
November 11, 2017: Journal of Pharmaceutical and Biomedical Analysis
https://www.readbyqxmd.com/read/29145085/analysis-of-microplastics-in-water-by-micro-raman-spectroscopy-release-of-plastic-particles-from-different-packaging-into-mineral-water
#6
Darena Schymanski, Christophe Goldbeck, Hans-Ulrich Humpf, Peter Fürst
Microplastics are anthropogenic contaminants which have been found in oceans, lakes and rivers. Investigations focusing on drinking water are rare and studies have mainly been using micro-Fourier Transform Infrared Spectroscopy (μ-FT-IR). A major limitation of this technique is its inability to detect particles smaller than 20 μm. However, micro-Raman spectroscopy is capable of detecting even smaller particle sizes. Therefore, we show that this technique, which was used in this study, is particularly useful in detecting microplastics in drinking water where particle sizes are in the low micrometer range...
November 6, 2017: Water Research
https://www.readbyqxmd.com/read/29145084/low-voltage-electric-potential-as-a-driving-force-to-hinder-biofouling-in-self-supporting-carbon-nanotube-membranes
#7
Chidambaram Thamaraiselvan, Avner Ronen, Sofia Lerman, Moran Balaish, Yair Ein-Eli, Carlos G Dosoretz
This study aimed at evaluating the contribution of low voltage electric field, both alternating (AC) and direct (DC) currents, on the prevention of bacterial attachment and cell inactivation to highly electrically conductive self-supporting carbon nanotubes (CNT) membranes at conditions which encourage biofilm formation. A mutant strain of Pseudomonas putida S12 was used a model bacterium and either capacitive or resistive electrical circuits and two flow regimes, flow-through and cross-flow filtration, were studied...
November 3, 2017: Water Research
https://www.readbyqxmd.com/read/29145080/comparing-the-efficacy-of-solid-and-magic-echo-refocusing-sequences-applications-to-1-h-nmr-echo-spectroscopy-of-shale-rock
#8
Gregory S Boutis, Ravinath Kausik
Quantitative evaluation of the solid and viscous components of unconventional shale rock, namely kerogen and bitumen, is important for understanding reservoir quality. Short transverse coherence times, due to strong (1)H-(1)H dipolar interactions, motivates the application of solid state refocusing pulse sequences that allow for investigating components of the free-induction decay that are otherwise obscured by instrumental effects such as probe ringdown. This work reports on static, wide-line (1)H spectroscopy of shale rock and their extracted components, which include kerogen and bitumen, by the application of solid echo and magic echo pulse sequences...
November 3, 2017: Solid State Nuclear Magnetic Resonance
https://www.readbyqxmd.com/read/29145059/binding-of-naringin-and-naringenin-with-hen-egg-white-lysozyme-a-spectroscopic-investigation-and-molecular-docking-study
#9
Sourav Das, Pooja Ghosh, Sudipta Koley, Atanu Singha Roy
The interactions of naringenin (NG) and naringin (NR) with Hen Egg White Lysozyme (HEWL) in aqueous medium have been investigated using UV-vis spectroscopy, steady-state fluorescence, circular dichroism (CD), Fourier Transform infrared spectroscopy (FT-IR) and molecular docking analyses. Both NG and NR can quench the intrinsic fluorescence of HEWL via static quenching mechanism. At 300K, the value of binding constant (Kb) of HEWL-NG complex (5.596±0.063×10(4)M(-1)) was found to be greater than that of HEWL-NR complex (3...
November 8, 2017: Spectrochimica Acta. Part A, Molecular and Biomolecular Spectroscopy
https://www.readbyqxmd.com/read/29145049/elements-content-in-tree-rings-from-xi-an-china-and-environmental-variations-in-the-past-30years
#10
Yu Liu, Weiyuan Ta, Paolo Cherubini, Ruoshi Liu, Yanchao Wang, Changfeng Sun
Using inductively coupled plasma mass spectrometry (ICP-MS) and inductively coupled plasma atomic emission spectroscopy (ICP-AES), the characteristics of chemical elements were analyzed in white poplar (Populus bonatii Levl.) and ailanthus (Ailanthus altissima (Mill.) Swingle) from three sites in the town of Xi'an, China. The results indicated that the concentration variations of Pb and Cd in tree rings were consistent with that of the environment where the trees were growing. P and Zn were translocated within tree rings to a certain degree, which led to an inaccurate pollution reconstruction...
November 13, 2017: Science of the Total Environment
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#11
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29144761/amphiphiles-without-head-and-tail-design-nanostructures-based-on-the-self-assembly-of-anionic-boron-cluster-compounds
#12
Roberto Fernandez-Alvarez, Vladimír Ďorďovič, Mariusz Uchman, Pavel Matejicek
Anionic boron hydride cluster compounds (ABCCs) are intrinsically amphiphilic building blocks suitable for nanochemistry. ABCCs are involved in atypical weak interactions, notably dihydrogen bonding, due to their peculiar polyhedral structure, consisting of negatively charged B-H units. The most striking feature of ABCCs that differentiates them from typical surfactants is the lack of head-and-tail structure. Furthermore, their structure can be described as intrinsically amphiphilic or aquaneutral. Therefore, classical terms established to describe self-assembly of classical amphiphiles are insufficient and need to be reconsidered...
November 16, 2017: Langmuir: the ACS Journal of Surfaces and Colloids
https://www.readbyqxmd.com/read/29144722/transport-across-heterointerfaces-of-amorphous-niobium-oxide-and-crystallographically-oriented-epitaxial-germanium
#13
Mantu K Hudait, Michael Brian Clavel, Jheng-Sin Liu, Aheli Ghosh, Nikhil Jain, Robert J Bodnar
Due to the high carrier mobility of germanium (Ge) and high dielectric permittivity of amorphous niobium pentoxide (a-Nb2O5), Ge/a-Nb2O5 heterostructures offer several advantages for the rapidly developing field of oxide-semiconductor-based multifunctional devices. To this end, we investigation the growth, structural, band alignment, and metal-insulator-semiconductor (MIS) electrical properties of physical vapor deposited Nb2O5 on crystallographically oriented (100)Ge, (110), and (111)Ge epilayers. The as-deposited Nb2O5 dielectrics were found to be in the amorphous state, demonstrating an abrupt oxide/semiconductor heterointerface with respect to Ge, when examined via low- and high-magnification cross-sectional transmission electron microscopy...
November 16, 2017: ACS Applied Materials & Interfaces
https://www.readbyqxmd.com/read/29144590/metabolic-profiling-of-normal-hepatocyte-and-hepatocellular-carcinoma-cells-via-1-h-nuclear-magnetic-resonance-spectroscopy
#14
Yang Chen, Zhong Chen, Jiang-Hua Feng, Yun-Bin Chen, Nai-Shun Liao, Ying Su, Chang-Yan Zou
Hepatocellular carcinoma (HCC) causes death mainly by disseminated metastasis progression from the organ being confined. Different metastatic stages are closely related to cellular metabolic profiles. Normal hepatocyte and HepG2 cell line from low metastatic HCC were studied by NMR-based metabolomic techniques. Multivariate and univariate statistical analyses were utilized to identify characteristic metabolites from cells and cultured media. Elevated levels of acetate, creatine, isoleucine, leucine, and phenylalanine were observed in HepG2 cells, suggesting more active in gathering nutrient components along with altered amino acid metabolisms and enhanced lipid metabolism...
November 16, 2017: Cell Biology International
https://www.readbyqxmd.com/read/29144589/-sphingosine-1-phosphate-immobilized-on-nanotopographical-scaffolds-improve-myogenic-differentiation
#15
Min Suk Lee, Hee Seok Yang
The skeletal muscle consists of highly aligned dense cables of collagen fibers with nanometer feature size to support muscle fibers. The skeletal myocyte can be greatly affected to differentiate by their surrounding topographical structure. To improve myogenic differentiation, we fabricated cell culture platform that sphingosine-1-phosphate (S1P) which regulated myocyte behavior was immobilized on a biomimetic nanopatterned polyurethaneacrylate (PUA) substrate using 3,4-dihydroxyphenylalanine (L-DOPA) for providing topographical and biological cues synergistically...
November 16, 2017: Biotechnology Journal
https://www.readbyqxmd.com/read/29144424/synthesis-characterization-and-biological-activities-of-biopolymeric-schiff-bases-prepared-with-chitosan-and-salicylaldehydes-and-their-pd-ii-and-pt-ii-complexes
#16
Hellen Franciane Gonçalves Barbosa, Maha Attjioui, Ana Paula Garcia Ferreira, Edward Ralph Dockal, Nour Eddine El Gueddari, Bruno M Moerschbacher, Éder Tadeu Gomes Cavalheiro
In an attempt to enhance chitosan biological activities, biopolymeric Schiff bases of chitosan and different salicylaldehydes and their palladium(II) and platinum(II) complexes were synthesized and tested. The chemical structures of these derivatives were characterized using ¹H-NMR, FTIR spectroscopy and XPRD. Thermal analysis was done through TGA/DTG-DTA. Electronic absorption spectra and surface morphologies were analyzed by SEM-EDAX. Chitosan and its derivatives were evaluated for their in vitro antimicrobial activity against two common bacterial and fungal plant pathogens Pseudomonas syringae pv...
November 16, 2017: Molecules: a Journal of Synthetic Chemistry and Natural Product Chemistry
https://www.readbyqxmd.com/read/29144417/fast-low-cost-and-non-destructive-physico-chemical-analysis-of-virgin-olive-oils-using-near-infrared-reflectance-spectroscopy
#17
Ana Garrido-Varo, María-Teresa Sánchez, María-José De la Haba, Irina Torres, Dolores Pérez-Marín
Near-Infrared (NIR) Spectroscopy was used for the non-destructive assessment of physico-chemical quality parameters in olive oil. At the same time, the influence of the sample presentation mode (spinning versus static cup) was evaluated using two spectrophotometers with similar optical characteristics. A total of 478 olive oil samples were used to develop calibration models, testing various spectral signal pre-treatments. The models obtained by applying MPLS regression to spectroscopic data yielded promising results for olive oil quality measurements, particularly for acidity, the peroxide index and alkyl and ethyl ester content...
November 16, 2017: Sensors
https://www.readbyqxmd.com/read/29144310/preparation-of-ureido-functionalized-pva-silica-mesoporous-fibre-membranes-via-electrospinning-for-adsorption-of-pb-2-and-cu-2-in-wastewater
#18
Meimei Zhou, Weizhen Tang, Pingping Luo, Jiqiang Lyu, Aixia Chen, Longkai Qiao, Daniel Nover
Ureido-functionalized mesoporous polyvinyl alcohol/silica composite nanofibre membranes were prepared by electrospinning technology and their application for removal of Pb(2+) and Cu(2+) from wastewater was discussed. The characteristics of the membranes were investigated by scanning electron microscopy, transmission electron microscopy, X-ray diffraction, and N2 adsorption-desorption analysis. Results show that the membranes have long fibrous shapes and worm-like mesoporous micromorphologies. Fourier transform infrared spectroscopy confirmed the membranes were successfully functionalized with ureido groups...
November 2017: Water Science and Technology: a Journal of the International Association on Water Pollution Research
https://www.readbyqxmd.com/read/29144307/reduction-of-chromium-vi-from-aqueous-solution-by-biomass-of-cladosporium-cladosporioides
#19
María Teresa Garza-González, Jonathan Eduardo Ramírez-Vázquez, María de Los Ángeles García-Hernández, María Elena Cantú-Cárdenas, Adriana Liñan-Montes, Juan Francisco Villarreal-Chiu
The capacity of Cladosporium cladosporioides biomass for removal of Cr(VI) in aqueous solutions was evaluated. A 2 × 2 factorial experiment design was used to study the effects of pH and biomass doses. Lower pH values and larger biomass doses increased the capacity of C. cladosporioides biomass for removal of Cr(VI), reaching a reduction capacity of 492.85 mg g(-1), a significantly higher value compared to other biomass reported. Cr(VI) removal kinetic rates followed a pseudo-second order model, like other fungal biomass reported previously...
November 2017: Water Science and Technology: a Journal of the International Association on Water Pollution Research
https://www.readbyqxmd.com/read/29144306/characterization-of-a-hybrid-polyacrylamide-and-its-flocculation-properties-in-cyanide-tailing-suspensions
#20
Ya Liu, Cuicui Lv, Jian Ding, Peng Qian, Yang Yu, Shufeng Ye, Yunfa Chen
An inorganic-organic hybrid flocculant Al(OH)3-polyacrylamide (Al-PAM) with narrow molecular weight distribution was synthesized using inverse microemulsion polymerization. The hybrid polymer Al-PAM was characterized by Infrared spectroscopy, thermogravimetric analysis, transmission electron microscopy and scanning electron microscopy, and it was found that it had a 'star-like' structure in which Al(OH)3 colloidal particles acted as cores linking PAM chains. The properties of Al-PAM were investigated in flocculating 10 wt% cyanide tailing suspensions...
November 2017: Water Science and Technology: a Journal of the International Association on Water Pollution Research
keyword
keyword
10934
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"