keyword
MENU ▼
Read by QxMD icon Read
search

Protein electrophoresis

keyword
https://www.readbyqxmd.com/read/28102850/japanese-encephalitis-virus-induces-human-neural-stem-progenitor-cell-death-by-elevating-grp78-phb-and-hnrnpc-through-er-stress
#1
Sriparna Mukherjee, Noopur Singh, Nabonita Sengupta, Mahar Fatima, Pankaj Seth, Anita Mahadevan, Susarla Krishna Shankar, Arindam Bhattacharyya, Anirban Basu
Japanese encephalitis virus (JEV), which is a causative agent of sporadic encephalitis, harbours itself inside the neural stem/progenitor cells. It is a well-known fact that JEV infects neural stem/progenitor cells and decreases their proliferation capacity. With mass spectrometry-based quantitative proteomic study, it is possible to reveal the impact of virus on the stem cells at protein level. Our aim was to perceive the stem cell proteomic response upon viral challenge. We performed a two-dimensional gel electrophoresis-based proteomic study of the human neural stem cells (hNS1 cell line) post JEV infection and found that 13 proteins were differentially expressed...
January 19, 2017: Cell Death & Disease
https://www.readbyqxmd.com/read/28102738/optimization-and-partial-characterization-of-intracellular-anticandidal-protein-from-aspergillus-giganteus-mtcc-8408-using-taguchi-doe
#2
Debashis Dutta, Mira Debnath Das
A new intracellular antifungal protein (afp) production with average molecular weight 24.3 kDa and yield of 0.65 ± 0.1 mg/gram dry cell weight (gdcw) of mycelia in submerged fermentation of Aspergillus giganteus MTCC 8408 was optimized. Taguchi's DOE (design of experiment) L27 orthogonal array (OA) was constructed using Qualitek-4 software with 8 most influensive factors namely, culture pH, temperature, slant age, inoculum volume, agitation and KH2PO4. Scanning electron microscopy (SEM) was used to correlate the effect of selected factors on fungal cell morphology and afp production...
January 19, 2017: Bioengineered
https://www.readbyqxmd.com/read/28101252/identification-of-proteins-from-wild-cardoon-flowers-cynara-cardunculus-l-by-a-proteomic-approach
#3
Amal Ben Amira, Julien Bauwens, Edwin De Pauw, Souhail Besbes, Hamadi Attia, Frédéric Francis, Christophe Blecker
Proteomic approach was applied to identify total proteins, particularly the enzymatic content, from wild cardoon flowers. As the selection of an appropriate sample preparation method is the key for getting reliable results, two different extraction/precipitation methods (trichloroacetic acid and phenol/ammonium acetate) were tested on fresh and lyophilized flowers. After two-dimensional electrophoresis (2D-E) separations, a better protein pattern was obtained after phenol extraction from lyophilized flowers...
January 2017: Journal of Chemical Biology
https://www.readbyqxmd.com/read/28098340/inhibitory-effect-of-blue-light-emitting-diode-on-migration-and-invasion-of-cancer-cells
#4
Phil-Sun Oh, Hyun-Soo Kim, Eun-Mi Kim, Hyosook Hwang, Hyang Hwa Ryu, SeokTae Lim, Myung-Hee Sohn, Hwan-Jeong Jeong
The aim of this study was to determine the effects and molecular mechanism of blue light emitting diode (LED) in tumor cells. A migration and invasion assay for the metastatic behavior of mouse colon cancer CT-26 and human fibrosarcoma HT-1080 cells was performed. Cancer cell migration-related proteins were identified by obtaining a 2-dimensional gel electrophoresis (2-DE) in total cellular protein profile of blue LED-irradiated cancer cells, followed by matrix-assisted laser desorption/ionization-time of flight (MALDI-TOF) analysis of proteins...
January 18, 2017: Journal of Cellular Physiology
https://www.readbyqxmd.com/read/28097424/analysis-of-the-spleen-proteome-of-chickens-infected-with-reticuloendotheliosis-virus
#5
Mei Xue, Yan Zhao, Shunlei Hu, Xingming Shi, Hongyu Cui, Yunfeng Wang
Infection with reticuloendotheliosis virus (REV), a gammaretrovirus in the family Retroviridae, can result in immunosuppression and subsequent increased susceptibility to secondary infections. In the present study, we identified differentially expressed proteins in the spleens of chickens infected with the REV-A HLJ07I strain, using two-dimensional gel electrophoresis on samples from time points coinciding with different phases of the REV life cycle. Differentially expressed proteins were identified using one-dimensional liquid chromatography electrospray ionization tandem mass spectrometry (1D LC ESI MS/MS)...
January 17, 2017: Archives of Virology
https://www.readbyqxmd.com/read/28096849/assessment-of-the-effects-of-extremely-low-frequency-electromagnetic-fields-on-toxoplasma-gondii
#6
Sercin Ozlem-Caliskan, Hatice Ertabaklar, Mehmet Dincer Bilgin, Sema Ertug
BACKGROUND: The effects of extremely low frequency electromagnetic fields (ELF-EMF) on Toxoplasma gondii have not been explained yet. The aim of this study was to assess the possible effects of ELF-EMF on growth, survival time and viability of Toxoplasma gondii. In addition, the life span of Toxoplasma infected animals was investigated. METHODS: Sixty adult male BALB/c mice were used for in vivo and in vivo experiments in Laboratory of Biopyhsics and Parasitology of Medical Faculty, Adnan Menderes University, Turkey, in 2010...
April 2016: Iranian Journal of Parasitology
https://www.readbyqxmd.com/read/28096233/role-of-the-constant-region-domain-in-the-structural-diversity-of-human-antibody-light-chains
#7
Emi Hifumi, Hiroaki Taguchi, Ryuichi Kato, Taizo Uda
Issues regarding the structural diversity (heterogeneity) of an antibody molecule have been the subject of discussion along with the development of antibody drugs. Research on heterogeneity has been extensive in recent years, but no clear solution has been reached. Heterogeneity is also observed in catalytic antibody κ light chains (CLs). In this study, we investigated how the constant region domain of CLs concerns structural diversity because it is a simple and good example for elucidating heterogeneity. By means of cation-exchange chromatography, SDS-PAGE, and 2-dimensional electrophoresis for the CL, multimolecular forms consisting of different electrical charges and molecular sizes coexisted in the solution, resulting in the similar heterogeneity of the full length of CLs...
January 17, 2017: FASEB Journal: Official Publication of the Federation of American Societies for Experimental Biology
https://www.readbyqxmd.com/read/28093073/application-of-meta-omics-techniques-to-understand-greenhouse-gas-emissions-originating-from-ruminal-metabolism
#8
REVIEW
Robert J Wallace, Timothy J Snelling, Christine A McCartney, Ilma Tapio, Francesco Strozzi
Methane emissions from ruminal fermentation contribute significantly to total anthropological greenhouse gas (GHG) emissions. New meta-omics technologies are beginning to revolutionise our understanding of the rumen microbial community structure, metabolic potential and metabolic activity. Here we explore these developments in relation to GHG emissions. Microbial rumen community analyses based on small subunit ribosomal RNA sequence analysis are not yet predictive of methane emissions from individual animals or treatments...
January 16, 2017: Genetics, Selection, Evolution: GSE
https://www.readbyqxmd.com/read/28091899/proteomic-study-of-blood-serum-in-coronary-atherosclerosis
#9
E M Stakhneva, I A Meshcheryakova, E A Demidov, K V Starostin, Yu I Ragino, S E Peltek, M I Voevoda
Changes in the blood serum proteins were assessed in men with coronary atherosclerosis and without coronary heart disease. Proteins were separated by 2D-electrophoresis, protein fractions were identified by their peptide fingerprint by MALDI method; fractions with more than twofold increase in protein level were determined. In blood serum of patients with coronary atherosclerosis, the content of C4 complement protein increased and ceruloplasmin level decreased, which is typical of heart failure and coronary heart disease...
January 2017: Bulletin of Experimental Biology and Medicine
https://www.readbyqxmd.com/read/28089894/determining-the-cleavage-site-for-the-mature-antimicrobial-peptide-of-nile-tilapia-%C3%AE-defensin-using-2d-electrophoresis-western-blot-and-mass-spectrometry-analysis
#10
Chin-I Chang, Li-Hao Chen, Yeh-Fang Hu, Chia-Che Wu, Jyh-Ming Tsai
Several proteomic techniques were used to determine the cleavage site of the mature antimicrobial peptide of Nile tilapia β-defensin. The computer-predicted Nile tilapia β-defensin ((25)ASFPWSCLSLSGVCRKVCLPTELFFGPLGCGKGSLCCVSHFL(66)) composed of 42 amino acids was chemically synthesized and prepared to produce an antibody for Western blotting. Total proteins from the skin of the Nile tilapia were separated on two-dimensional electrophoresis, and the spot of Nile tilapia β-defensin was recognized using Western blot analysis...
January 9, 2017: Fish & Shellfish Immunology
https://www.readbyqxmd.com/read/28088252/quantification-of-whey-protein-content-in-infant-formulas-by-sds-cge
#11
Ping Feng, Christophe Fuerer, Adrienne McMahon
Protein separation by SDS-CGE (Sodium Dodecyl Sulfate - Capillary Gel Electrophoresis) followed by UV absorption at 220nm allows quantification of major proteins in raw milk. In processed dairy samples such as skim milk powder and infant formulas, signals from individual proteins are less resolved, but caseins still migrate as one family between two groups of whey proteins. In the first group, α-Lactalbumin and β-Lactoglobulin migrate as two distinct peaks. Lactosylated adducts show delayed migration times and interfere with peak separation, but both native and modified forms, as well as other low molecular weight whey proteins, still elute before the caseins...
November 18, 2016: Journal of AOAC International
https://www.readbyqxmd.com/read/28087334/the-short-and-long-term-proteomic-effects-of-sleep-deprivation-on-the-cortical-and-thalamic-synapses
#12
Attila Simor, Balázs András Györffy, Péter Gulyássy, Katalin Völgyi, Vilmos Tóth, Mihail Ivilinov Todorov, Viktor Kis, Zsolt Borhegyi, Zoltán Szabó, Tamás Janáky, László Drahos, Gábor Juhász, Katalin Adrienna Kékesi
Acute total sleep deprivation (SD) impairs memory consolidation, attention, working memory and perception. Structural, electrophysiological and molecular experimental approaches provided evidences for the involvement of sleep in synaptic functions. Despite the wide scientific interest on the effects of sleep on the synapse, there is a lack of systematic investigation of sleep-related changes in the synaptic proteome. We isolated parietal cortical and thalamic synaptosomes of rats after 8 h of total SD by gentle handling and 16 h after the end of deprivation to investigate the short- and longer-term effects of SD on the synaptic proteome, respectively...
January 10, 2017: Molecular and Cellular Neurosciences
https://www.readbyqxmd.com/read/28080905/plasma-protein-electrophoresis-and-select-acute-phase-proteins-in-healthy-bonnethead-sharks-sphyrna-tiburo-under-managed-care
#13
Michael W Hyatt, Cara L Field, Tonya M Clauss, Kristopher L Arheart, Carolyn Cray
Preventative health care of elasmobranchs is an important but understudied field of aquatic veterinary medicine. Evaluation of inflammation through the acute phase response is a valuable tool in health assessments. To better assess the health of bonnethead sharks ( Sphyrna tiburo ) under managed care, normal reference intervals of protein electrophoresis (EPH) and the acute phase proteins, C-reactive protein (CRP) and haptoglobin (HP), were established. Blood was collected from wild caught, captive raised bonnethead sharks housed at public aquaria...
December 2016: Journal of Zoo and Wildlife Medicine: Official Publication of the American Association of Zoo Veterinarians
https://www.readbyqxmd.com/read/28078650/in-vivo-efficacy-of-latex-from-calotropis-procera-in-ameliorating-fever-biochemical-characteristics-and-plausible-mechanism
#14
Vijay L Kumar, B Guruprasad, Syed Meraj A Fatmi, Priyanka Chaudhary, Nylane Maria Nunes Alencar, José Vitor Moreira Lima-Filho, Márcio Viana Ramos
Calotropis procera latex fractions possessing anti-inflammatory property were characterized for their biochemical properties, compared for their efficacy in ameliorating fever in rats and their mechanism of action was elucidated. Aqueous fraction and methanol extract (AqDL and MeDL) were derived from the dried latex (DL) and proteins were separated from the fresh latex (LP). Polyacrylamide gel electrophoresis carried out under denaturing conditions showed the presence of proteins with some similarity in LP and AqDL and both of these fractions exhibited proteinase activity by gelatin zymography...
January 11, 2017: Applied Biochemistry and Biotechnology
https://www.readbyqxmd.com/read/28078386/early-differences-in-islets-from-prediabetic-nod-mice-combined-microarray-and-proteomic-analysis
#15
Inne Crèvecoeur, Valborg Gudmundsdottir, Saurabh Vig, Fernanda Marques Câmara Sodré, Wannes D'Hertog, Ana Carolina Fierro, Leentje Van Lommel, Conny Gysemans, Kathleen Marchal, Etienne Waelkens, Frans Schuit, Søren Brunak, Lut Overbergh, Chantal Mathieu
AIMS/HYPOTHESIS: Type 1 diabetes is an endocrine disease where a long preclinical phase, characterised by immune cell infiltration in the islets of Langerhans, precedes elevated blood glucose levels and disease onset. Although several studies have investigated the role of the immune system in this process of insulitis, the importance of the beta cells themselves in the initiation of type 1 diabetes is less well understood. The aim of this study was to investigate intrinsic differences present in the islets from diabetes-prone NOD mice before the onset of insulitis...
January 12, 2017: Diabetologia
https://www.readbyqxmd.com/read/28072497/covalently-connected-polymer-protein-nanostructures-fabricated-by-reactive-self-assembly-approach
#16
Hanying Zhao, Yuanyuan Ju, Cheng Xing, Dongxia Wu, Yunfang Wu, Lianyong Wang
In this research, covalently connected polymer-protein nanostructures were fabricated by reactive self-assembly approach. PtBMA-co-PPDSMA was synthesized by reversible addition fragmentation chain transfer (RAFT) polymerization. Covalently connected nanostructures (CCNs) with hydrophobic polymer cores and hydrophilic protein coronae were prepared by adding PtBMA-co-PPDSMA/DMF solutions into bovine serum albumin (BSA) aqueous solutions. The thiol-disulfide exchange reaction between the pyridyl disulfide groups on the polymer chains and the thiol groups on the protein molecules plays a key role in the fabrication of CCNs...
January 10, 2017: Chemistry: a European Journal
https://www.readbyqxmd.com/read/28071612/expression-of-raf-kinase-inhibitor-protein-in-human-hepatoma-tissues-by-two-dimensional-gel-electrophoresis-and-matrix-assisted-laser-desorption-ionization-time-of-flight-methods
#17
D A Tsao, Y F Shiau, C S Tseng, H R Chang
PURPOSE: Hepatocellular carcinoma (HCC) is the most common malignant liver tumor. To reduce the mortality and improve the effectiveness of therapy, it is important to search for changes in tumor-specific biomarkers whose function may involve in disease progression and which may be useful as potential therapeutic targets. Materials and Mehtods: In this study, we use two-dimensional polyacrylamide gel electrophoresis (2-DE) and matrix-assisted laser desorption/ionization time-of-flight mass spectrometry to observe proteome alterations of 12 tissue pairs isolated from HCC patients: Normal and tumorous tissue...
April 2016: Indian Journal of Cancer
https://www.readbyqxmd.com/read/28070779/hydrolytic-activity-of-esterase-antibody-complexes-retained-within-gel-capsules-after-complex-isolation
#18
Youji Shimazaki, Rino Miyatsuka
Delipidation in biological samples is important for some diagnostic tests and protein analyses. Lipids in the samples can be hydrolyzed by native esterases (ESs) within gel capsules after ES, and ES-antibody complexes are specifically trapped, extracted, and separated. Acrylamide and agarose gel capsules containing complexes of ES antibody were produced after the complexes were extracted using protein A-immobilized membranes, separated by non-denaturing electrophoresis, and stained by colloidal silver using glucose as a reductant...
January 9, 2017: Applied Biochemistry and Biotechnology
https://www.readbyqxmd.com/read/28070584/changes-in-protein-expression-profiles-in-bovine-endometrial-epithelial-cells-exposed-to-e-coli-lps-challenge
#19
Cristian Piras, Yongzhi Guo, Alessio Soggiu, Metasu Chanrot, Viviana Greco, Andrea Urbani, Gilles Charpigny, Luigi Bonizzi, Paola Roncada, Patrice Humblot
E. coli is one of the most frequently involved bacteria in uterine diseases. Lipopolysaccharide (LPS) is a component of the outer membrane of Gram-negative bacteria involved in pathogenic processes leading to post-partum metritis and endometritis in cattle. It also causes inflammation of the endometrium. The increase of cell proliferation by LPS is part of the inflammatory process. The aim of this study was to investigate possible changes in protein expression in relation to the proliferative response of bEECs after challenge with E...
January 10, 2017: Molecular BioSystems
https://www.readbyqxmd.com/read/28069130/comparison-of-gel-properties-and-biochemical-characteristics-of-myofibrillar-protein-from-bighead-carp-aristichthys-nobilis-affected-by-frozen-storage-and-a-hydroxyl-radical-generation-oxidizing-system
#20
Han Lu, Longteng Zhang, Qingzheng Li, Yongkang Luo
We wanted to clarify whether gel properties can be affected by in vivo or in vitro myofibrillar protein oxidation and, thus, to provide relevant information and a scientific foundation for the processing of gel products. To accomplish this, we measured the changes in sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), total disulfide (SS) content, surface hydrophobicity (So-ANS), carbonyl content, and gel texture and water-holding capacity (WHC) of isolated myofibrillar protein from bighead carp fillets during frozen storage and under different H2O2 concentrations, which were used to represent in vivo and in vitro conditions, respectively...
May 15, 2017: Food Chemistry
keyword
keyword
102299
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"