journal
MENU ▼
Read by QxMD icon Read
search

Amino Acids

journal
https://www.readbyqxmd.com/read/28540509/short-term-supplementation-of-isocaloric-meals-with-l-tryptophan-affects-pig-growth
#1
H N Liu, C-A A Hu, M M Bai, Gang Liu, M C B Tossou, K Xu, F N Li, P Liao, X F Kong, X Wu, Y L Yin
L-Tryptophan (Trp) and some of its metabolites regulate the circadian rhythm in mammals. We aimed to investigate the effects of short-term supplementation of Trp in isocaloric meals on growth performance using the parameters of multiple blood biomarkers and free amino acids in growing pigs. A total of 32 Landrace × Yorkshire barrows with a mean body weight of 8.64 (±1.13) kg were randomly assigned to four groups and then fed with various concentrations of Trp diets daily. Our results showed that sequential supplementation of different concentrations of Trp in isocaloric meals decreased the feed:gain (F:G) ratio (P = 0...
May 24, 2017: Amino Acids
https://www.readbyqxmd.com/read/28536844/evaluation-of-neurotensin-receptor-1-as-a-potential-imaging-target-in-pancreatic-ductal-adenocarcinoma
#2
Xiaoqin Yin, Mengzhe Wang, Hui Wang, Huaifu Deng, Tingting He, Yue Tan, Zehua Zhu, Zhanhong Wu, Shuo Hu, Zibo Li
Pancreatic cancer is one of the deadliest human malignancies and lack of effective diagnostic and therapeutic methods. Accumulating evidence suggests that the neurotensin (NT) and neurotensin receptors (NTRs) play key roles in pancreatic adenocarcinoma growth and survival. In this study, we not only evaluate the NTR1 expression in pancreatic cancer patient samples, but also explore the PET and fluorescence imaging of NTR1 expression in pancreatic cancer animal models. The NTR1 expression was evaluated by immunohistochemistry staining in clinical patient tissue samples with pancreatic ductal adenocarcinoma, insulinoma, and pancreatitis...
May 23, 2017: Amino Acids
https://www.readbyqxmd.com/read/28536843/human-interstitial-cellular-model-in-therapeutics-of-heart-valve-calcification
#3
REVIEW
Caimei He, Hai Tang, Zijian Mei, Nichujie Li, Zhi Zeng, Kwame Oteng Darko, Yulong Yin, Chien-An Andy Hu, Xiaoping Yang
Calcific aortic valve disease is a common, severe heart condition that is currently with no proven, effective drug treatment and requires a surgical valve replacement or an entire heart explanation. Thus, developing novel, targeted therapeutic approaches becomes a major goal for cardiovascular disease research. To achieve this goal, isolated heart valve interstitial cells could be an advanced model to explore molecular mechanisms and measure drug efficacy. Based on this progress, molecular mechanisms that harbor components of  inflammation and fibrosis coupled with proteins, for example, BMP-2, TLRs, RANKL, Osteoprotegerin, have been proposed...
May 23, 2017: Amino Acids
https://www.readbyqxmd.com/read/28534176/functions-of-pregnane-x-receptor-in-self-detoxification
#4
REVIEW
Liuqin He, Xihong Zhou, Niu Huang, Huan Li, Tiejun Li, Kang Yao, Yanan Tian, Chien-An Andy Hu, Yulong Yin
Pregnane X receptor (PXR, NR1I2), a member of the nuclear receptor superfamily, is a crucial regulator of nutrient metabolism and metabolic detoxification such as metabolic syndrome, xenobiotic metabolism, inflammatory responses, glucose, cholesterol and lipid metabolism, and endocrine homeostasis. Notably, much experimental and clinical evidence show that PXR senses xenobiotics and triggers the detoxification response to prevent diseases such as diabetes, obesity, intestinal inflammatory diseases and liver fibrosis...
May 22, 2017: Amino Acids
https://www.readbyqxmd.com/read/28523379/novel-dna-rna-targeting-amino-acid-beacon-for-the-versatile-incorporation-at-any-position-within-the-peptide-backbone
#5
Tamara Šmidlehner, Ivo Piantanida
One-pot tandem synthesis was for the first time applied to attach fluorophore to the amino acid side chain, yielding amino acid ready for peptide coupling at the N-terminus, and also upon activation at the C-terminus. Two new compounds differing only in fluorophore-linker length showed exceptional fluorimetric and CD recognition between DS-RNA and DS-DNA, thus being promising beacons for versatile peptide incorporation.
May 18, 2017: Amino Acids
https://www.readbyqxmd.com/read/28516269/%C3%AE-alanine-intercede-metabolic-recovery-for-amelioration-of-human-cervical-and-renal-tumors
#6
Muthuraman Pandurangan, Gansukh Enkhtaivan, Bhupendra Mistry, Rahul V Patel, Sohyun Moon, Doo Hwan Kim
β-Alanine is a non-essential amino acid and presents as a major component of various sports supplements. It is a non-proteogenic amino acid, formed in vivo by degradation of carnosine, anserine, balenine, and dihydrouracil. The present study was aimed at investigating the anti-tumor effects of β-alanine in renal and cervical tumor cells. Sulforhodamine-B assay and flow cytometric analysis were used to measure cell viability. Lactate dehydrogenase (LDH) expression was analyzed using FITC-conjugated fluorescent antibody...
May 17, 2017: Amino Acids
https://www.readbyqxmd.com/read/28516268/gpna-inhibits-the-sodium-independent-transport-system-l-for-neutral-amino-acids
#7
Martina Chiu, Cosimo Sabino, Giuseppe Taurino, Massimiliano G Bianchi, Roberta Andreoli, Nicola Giuliani, Ovidio Bussolati
L-γ-Glutamyl-p-nitroanilide (GPNA) is widely used to inhibit the glutamine transporter ASCT2, although it is known that it also inhibits other sodium-dependent amino acid transporters. In a panel of human cancer cell lines, which express the system L transporters LAT1 and LAT2, GPNA inhibits the sodium-independent influx of leucine and glutamine. The kinetics of the effect suggests that GPNA is a low affinity, competitive inhibitor of system L transporters. In Hs683 human oligodendroglioma cells, the incubation in the presence of GPNA, but not ASCT2 silencing, lowers the cell content of leucine...
May 17, 2017: Amino Acids
https://www.readbyqxmd.com/read/28497266/an-insecticidal-toxin-from-nephila-clavata-spider-venom
#8
Lin Jin, Mingqian Fang, Mengrou Chen, Chunling Zhou, Rose Ombati, Md Abdul Hakim, Guoxiang Mo, Ren Lai, Xiuwen Yan, Yumin Wang, Shilong Yang
Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis...
May 11, 2017: Amino Acids
https://www.readbyqxmd.com/read/28487998/effects-of-dietary-l-tryptophan-supplementation-on-intestinal-response-to-chronic-unpredictable-stress-in-broilers
#9
Yunshuang Yue, Yuming Guo, Ying Yang
Stress has been recognized as a critical risk factor for gastrointestinal diseases in both humans and animals. However, nutritional strategies to attenuate stress-induced intestinal barrier function and underlying mechanisms remain largely unknown. This study tested the hypothesis that L-tryptophan enhanced intestinal barrier function by regulating mucosal serotonin metabolism in chronic unpredictable stress-exposed broilers. One-day-old male broilers (Arbor Acres) were fed a basal diet supplemented with or without L-tryptophan in the absence or presence of chronic unpredictable stress...
May 9, 2017: Amino Acids
https://www.readbyqxmd.com/read/28478585/relevance-of-autophagy-to-fatty-liver-diseases-and-potential-therapeutic-applications
#10
REVIEW
Shengmin Yan, Nazmul Huda, Bilon Khambu, Xiao-Ming Yin
Autophagy is an evolutionarily conserved lysosome-mediated cellular degradation program. Accumulating evidence shows that autophagy is important to the maintenance of liver homeostasis. Autophagy involves recycling of cellular nutrients recycling as well as quality control of subcellular organelles. Autophagy deficiency in the liver causes various liver pathologies. Fatty liver disease (FLD) is characterized by the accumulation of lipids in hepatocytes and the dysfunction in energy metabolism. Autophagy is negatively affected by the pathogenesis of FLD and the activation of autophagy could ameliorate steatosis, which suggests a potential therapeutic approach to FLD...
May 6, 2017: Amino Acids
https://www.readbyqxmd.com/read/28478584/lac-l-tta-a-novel-lactose-based-amino-acid-sugar-conjugate-for-anti-metastatic-applications
#11
Giovanni N Roviello, Roberta Iannitti, Rosanna Palumbo, Hayarpi Simonyan, Caterina Vicidomini, Valentina Roviello
Here we describe the synthesis, chromatographic purification, MS and NMR characterization of a new lactosyl-derivative, i.e. a lactosyl thiophenyl-substituted triazolyl-thione L-alanine (Lac-L-TTA). This amino acid-sugar conjugate was prepared by solution synthesis in analogy to the natural fructosyl-amino acids. Furthermore, we investigated the inhibition of PC-3 prostate cancer cell colony formation by this lactose derivative in comparison with the less polar fructose-based derivative, Fru-L-TTA. This let us to compare the properties of the artificial derivative, object of the present work, with the monosaccharide-based counterpart and to obtain a preliminary information on the influence of polarity on such biological activity...
May 6, 2017: Amino Acids
https://www.readbyqxmd.com/read/28474127/conformational-stabilization-of-fox-dna-complex-architecture-to-sensitize-prostate-cancer-chemotherapy
#12
Bin Chen, Huiqiang Wang, Zhun Wu, Bo Duan, Peide Bai, Kaiyan Zhang, Wei Li, Jiaxin Zheng, Jinchun Xing
The forkhead box (FOX) transcription factor is a family of tumor suppressors that negatively regulates the tumorigenesis activity of prostate cancer; stabilization of FOX-DNA complex architecture has been recognized as a new and promising strategy for sensitizing cancer chemotherapy. Here, we described a systematic method that combined in silico analysis and in vitro assay to investigate the intermolecular interaction between FOX DNA-binding domain (DBD) and its cognate DNA partner. The structural and energetic information harvested from the molecular investigation were used to guide high-throughput virtual screening against a structurally diverse, nonredundant library of natural product compounds, aiming at discovery of novel small-molecule medicines that can conformationally stabilize and promote FOX-DNA recognition and interaction...
May 4, 2017: Amino Acids
https://www.readbyqxmd.com/read/28474126/sex-differences-in-amino-acids-lost-via-sweating-could-lead-to-differential-susceptibilities-to-disturbances-in-nitrogen-balance-and-collagen-turnover
#13
R H Dunstan, D L Sparkes, B J Dascombe, C J Stevens, G R Murphy, M M Macdonald, J Gottfries, C-G Gottfries, T K Roberts
Fluid collected during sweating is enriched with amino acids derived from the skin's natural moisturising factors and has been termed "faux" sweat. Little is known about sex differences in sweat amino acid composition or whether faux sweat amino acid losses affect nitrogen balance. Faux sweat collected by healthy adults (n = 47) after exercise, and at rest by chronic fatigue patients, was analysed for amino acid composition. Healthy females had higher total amino acid concentrations in sweat (10.5 ± 1...
May 4, 2017: Amino Acids
https://www.readbyqxmd.com/read/28474125/design-synthesis-and-biological-evaluation-of-novel-peptides-as-potential-agents-with-anti-tumor-and-multidrug-resistance-reversing-activities
#14
Bo Zhang, Wei Shi, Jieming Li, Chen Liao, Mingxue Li, Wenlong Huang, Hai Qian
Tumor chemotherapy is an important mean in the clinical treatment of metastatic cancer,but low selectivity and drug resistance restrict its clinical application. BP100 is a multifunctional membrane-active peptide with high antimicrobial activity. We selected BP100 as a lead peptide, designed and synthesized a series of BP100 analogs through solid-phase synthesis. Amongst them, peptides with the Tyr10 residue substituted by leucine and histidine showed the highest anti-cancer activity. Further experiments revealed that BP100 and its analogs could disrupt the cell membrane and trigger the cytochrome C release into cytoplasm, which ultimately resulted in apoptosis...
May 4, 2017: Amino Acids
https://www.readbyqxmd.com/read/28451782/oligo-and-polypeptide-conjugates-of-cationic-porphyrins-binding-cellular-uptake-and-cellular-localization
#15
Ádám Orosz, Szilvai Bősze, Gábor Mező, Ildikó Szabó, Levente Herényi, Gabriella Csík
Recently, we have characterized the DNA and nucleoprotein (NP) binding of bis(4-N-methylpyridyl)-15,20-di(4-carboxyphenyl)porphyrin (BMPCP) and meso-tri(4-N-methylpyridyl)-mono(4-carboxyphenyl)porphyrin (TMPCP) and their tetrapeptide conjugates (BMPCP-4P2 and TMPCP-4P, respectively). In this work, we investigated the interaction of TMPCP conjugated to the tetrapeptide branches of branched chain polymeric polypeptide with poly-L-lysine backbone (AK) with DNA or NP using spectroscopic methods. Analysis of absorption spectra revealed the external binding but no intercalation of TMPCP-AK to DNA...
April 27, 2017: Amino Acids
https://www.readbyqxmd.com/read/28444456/free-leucine-supplementation-during-an-8-week-resistance-training-program-does-not-increase-muscle-mass-and-strength-in-untrained-young-adult-subjects
#16
Andreo Fernando Aguiar, Alan Pablo Grala, Rubens Alexandre da Silva, Lúcio Flávio Soares-Caldeira, Francis Lopes Pacagnelli, Alex Silva Ribeiro, Douglas Kratki da Silva, Walquíria Batista de Andrade, Mario Carlos Welin Balvedi
The purpose of this study was to examine the effects of free leucine supplementation on changes in skeletal muscle mass and strength during a resistance training (RT) program in previously untrained, young subjects. In a double-blind, randomized, placebo-controlled study, 20 healthy young (22 ± 2 years) participants were assigned to two groups: a placebo-supplement group (PLA, N = 10) or a leucine-supplement group (LEU, N = 10). Both groups underwent an 8-week hypertrophic RT program (2 days/week), consuming an equivalent amount of leucine (3...
April 25, 2017: Amino Acids
https://www.readbyqxmd.com/read/28434046/oral-arginine-supplementation-protects-female-mice-from-the-onset-of-non-alcoholic-steatohepatitis
#17
Cathrin Sellmann, Christian Degen, Cheng Jun Jin, Anika Nier, Anna Janina Engstler, Dana Hasan Alkhatib, Jean-Pascal De Bandt, Ina Bergheim
Dietary arginine (Arg) supplementation has been proposed to have positive effects on the development of liver diseases. In the present study, we investigate if an oral Arg supplementation in diet protects mice fed a fructose, fat and cholesterol enriched Western-style diet (WSD) from the development of non-alcoholic steatohepatitis (NASH). Female C57BL/6J mice were fed a liquid control diet or a liquid WSD ± Arg (2.49 g/kg body weight/day) for 6 weeks. Indices of liver injury, glucose metabolism and intestinal permeability were determined...
April 22, 2017: Amino Acids
https://www.readbyqxmd.com/read/28432424/variations-of-isovaline-structure-related-to-activity-in-the-formalin-foot-assay-in-mice
#18
Timothy Fung, Yahya I Asiri, Richard Wall, Stephan K W Schwarz, Ernest Puil, Bernard A MacLeod
Current centrally acting analgesics such as opioids are associated with adverse effects that limit their use and threaten patient safety. Isovaline is a novel prototype analgesic that produces peripheral antinociception in several pain models with little or no effect on the central nervous system. The aim of this study was to establish a preliminary structure-activity relationship for isovaline derivatives by assaying efficacy in the formalin foot assay and central adverse effect profile in mice. Selected compounds were tested using the formalin foot assay to determine efficacy in reducing formalin-induced behaviors...
April 21, 2017: Amino Acids
https://www.readbyqxmd.com/read/28429125/low-plasma-homoarginine-concentration-is-associated-with-high-rates-of-all-cause-mortality-in-renal-transplant-recipients
#19
Arslan Arinc Kayacelebi, Isidor Minović, Erik Hanff, Anne-Roos S Frenay, Martin H de Borst, Martin Feelisch, Harry van Goor, Stephan J L Bakker, Dimitrios Tsikas
In renal transplant recipients (RTR), we recently found that low urinary excretion of homoarginine (hArg) is associated with mortality and graft failure. However, it is not known whether such prospective associations also hold true for plasma concentrations of hArg. In the present study, we therefore determined plasma concentrations of hArg in the same cohort, i.e. in 687 RTR (functioning graft ≥1 year), and in 140 healthy donors, before and after kidney donation. Plasma hArg concentrations were significantly lower in RTR compared to healthy controls [1...
April 20, 2017: Amino Acids
https://www.readbyqxmd.com/read/28421297/suppression-of-th1-differentiation-by-tryptophan-supplementation-in-vivo
#20
Tobias V Lanz, Simon Becker, Soumya R Mohapatra, Christiane A Opitz, Wolfgang Wick, Michael Platten
Metabolism of the essential amino acid tryptophan (trp) is a key endogenous immunosuppressive pathway restricting inflammatory responses. Tryptophan metabolites promote regulatory T cell (Treg) differentiation and suppress proinflammatory T helper cell (Th)1 and Th17 phenotypes. It has been shown that treatment with natural and synthetic tryptophan metabolites can suppress autoimmune neuroinflammation in preclinical animal models. Here, we tested if oral intake of tryptophan would increase immunosuppressive tryptophan metabolites and ameliorate autoimmune neuroinflammation as a safe approach to treat autoimmune disorders like multiple sclerosis (MS)...
April 18, 2017: Amino Acids
journal
journal
30901
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"