journal
MENU ▼
Read by QxMD icon Read
search

Journal of Colloid and Interface Science

journal
https://www.readbyqxmd.com/read/29145019/ordered-cylindrical-micropatterned-petri-dishes-used-as-scaffolds-for-cell-growth
#1
Van-Tien Bui, Le Thi Thuy, Joon Sig Choi, Ho-Suk Choi
Three-dimensional (3D) culture dish patterned with a microwell structure demonstrates a great application potential in biotechnology. This study reports on the easy fabrication of an ordered customizable honeycomb microwell array on the surface of polymer substrates including the commercial Petri dish to create a biological platform for cell culture. The fabrication method is based on a very simple solvent dip-coating technique and the methanol accumulation-induced phase separation in which a binary mixture of chloroform and methanol is used to induce a ternary solution and to guarantee the formation of the ordered pore array on the substrate...
November 10, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29145018/nitrogen-phosphorus-dual-doped-molybdenum-carbide-molybdenum-phosphide-carbon-nanospheres-for-efficient-hydrogen-evolution-over-the-whole-ph-range
#2
Jing-Qi Chi, Wen-Kun Gao, Jia-Hui Lin, Bin Dong, Kai-Li Yan, Jun-Feng Qin, Zi-Zhang Liu, Yong-Ming Chai, Chen-Guang Liu
MoO4(2-)@aniline-pyrrole (MoO4(2-)@polymer) spheres as precursors have been used to synthesize unique core-shell nanostructure consisting of molybdenum carbide and molybdenum phosphide composites encapsulated into uniformly dual N, P-doped carbon shells (Mo2C/MoP@NPC) through a facile two-step strategy. Firstly, porous core-shell N-doped Mo2C@C (Mo2C@NC) nanospheres have been synthesized with ultrafine Mo2C nanoparticles as core and ultrathin NC as shell by a annealing route. Secondly, Mo2C/MoP@NPC has been obtained maintaining intact spherical-like morphology through a phosphidation reaction in high temperature...
November 10, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29132107/removal-of-phosphate-from-water-by-lanthanum-modified-zeolites-obtained-from-fly-ash
#3
Joanna Goscianska, Magdalena Ptaszkowska-Koniarz, Marcin Frankowski, Malgorzata Franus, Rafal Panek, Wojciech Franus
The possibility and effectiveness of removal of phosphate from aqueous solutions with the use of new low-cost synthetic zeolites obtained from fly ash and modified with lanthanum, was studied. Physicochemical properties of the zeolites were characterized by different techniques such as X-ray diffraction, low-temperature nitrogen sorption and scanning electron microscopy. It has been established that lanthanum is preferentially located in the zeolites channels and cages, which is related to the ion-exchange method of modification...
November 10, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29136545/removal-of-tetracycline-by-fe-ni-bimetallic-nanoparticles-in-aqueous-solution
#4
Haoran Dong, Zhao Jiang, Cong Zhang, Junmin Deng, Kunjie Hou, Yujun Cheng, Lihua Zhang, Guangming Zeng
This study investigated the degradation of tetracycline (TC) by Fe/Ni bimetallic nanoparticles (Fe/Ni BNPs) and nanoscale zero-valent iron (NZVI) in aqueous solution. Results revealed that Fe/Ni BNPs showed much better performance than NZVI. The effects of pH (5, 7 and 9), initial TC concentration and competitive anions (NO3(-), H2PO4(-), SO4(2-) and HCO3(-)) on the removal of TC by Fe/Ni BNPs were investigated. The results indicated that the removal of TC was higher under acidic conditions and the reaction reached equilibrium more quickly at lower initial TC concentrations...
November 8, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29127824/effects-of-subphase-ph-temperature-and-ionic-strength-on-the-aggregation-behavior-of-pnba-b-paa-at-the-air-water-interface
#5
Yuhang Wang, Gangyao Wen, Stergios Pispas, Shicheng Yang, Kun You
Aggregation behavior of an amphiphilic diblock polyelectrolyte poly(n-butylacrylate)-b-poly(acrylic acid) (PnBA-b-PAA) at the air/water interface and morphologies of its LB films were characterized by the Langmuir monolayer technique and atomic force microscopy (AFM), respectively. Effects of subphase pH, temperature and ionic strength on the isotherms and hysteresis curves of the PnBA-b-PAA monolayers and the morphologies of its LB films were systematically studied. With the increase of subphase pH, the isotherms shift negatively and the quasi-plateaus disappear under neutral and alkaline conditions...
November 8, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29136546/multi-component-hybrid-soft-ionogels-for-photoluminescence-tuning-and-sensing-organic-solvent-vapors
#6
Jing Ma, Bing Yan
This paper tries to prepare soft ionogels through the carboxyl ion liquid (IM(+)Br(-)) as double chemical linker connecting both Bio-MOF-1 (Zn8(ad)4(BPDC)6O·2Me2NH2, BPDC=biphenyl-4,4'-dicarboxylate, Ad = adeninate) and lanthanide complexes. Among anionic Bio-MOF-1 interacts with IM(+)Br(-) through cation exchange (IM(+)) to form BMOF-IM and lanthanide ions are further introduced through the coordination to the carboxylic group of IM(+) together with Phen (1,10-phenanthroline) as assistant ligand for Ln(3+) (Ln = Eu, Tb or Eu/Tb)...
November 7, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29126073/facile-synthesis-of-ultrafine-cobalt-oxides-embedded-into-n-doped-carbon-with-superior-activity-in-hydrogenation-of-4-nitrophenol
#7
Xiuling Zhang, Na Wang, Longlong Geng, Junna Fu, Hui Hu, Dashuai Zhang, Baoyong Zhu, Jesse Carozza, Haixiang Han
Design and synthesis of low-cost catalysts with high activity and stability for hydrogenation reactions is an important research area of applied catalysis. In this work, we present a kind of ultrafine cobalt oxides encapsulated by N-doped carbon (donated as CoOx/CN) as efficient catalysts for hydrogenation of 4-nitrophenol (4-NP) process. The CoOx/CN was fabricated through a pyrolysis strategy using an N-containing metal-organic framework (Co-MOF) as precursor followed by a fine thermal-treatment. With an optimized pyrolysis temperature of 500 °C, the CoOx species present as ultrafine particles highly dispersed in the obtained catalyst (CoOx/CN-500)...
November 7, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29145017/membrane-interactions-of-microgels-as-carriers-of-antimicrobial-peptides
#8
Randi Nordström, Lina Nyström, Oliver C J Andrén, Michael Malkoch, Anita Umerska, Mina Davoudi, Artur Schmidtchen, Martin Malmsten
Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29132108/facile-formation-of-metallic-bismuth-bismuth-oxide-heterojunction-on-porous-carbon-with-enhanced-photocatalytic-activity
#9
Liping Zhang, Pramila Ghimire, Jenjira Phuriragpitikhon, Baojiang Jiang, Alexandre A S Gonçalves, Mietek Jaroniec
Bismuth/bismuth oxide heterojunction on porous carbon (Bi(0)/Bi2O3@C) was successfully prepared by a surfactant-assisted sol-gel method. This composite photocatalyst was fabricated by depositing Bi2O3 and metallic bismuth nanoparticles (NPs) on porous carbon sheets. Bi NPs were created by in-situ reduction of Bi2O3 with amorphous carbon. During the synthesis, bismuth and carbon precursors were mixed in different ratios, resulting in distinct amounts of metallic bismuth in the composites. The composites showed large specific surface area and pore volume as well as strong light absorption ability due to the existing carbon...
November 6, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29128618/gold-nanoparticles-functionalized-by-rhodamine-b-isothiocyanate-a-new-tool-to-control-plasmonic-effects
#10
Ilaria Fratoddi, Antonella Cartoni, Iole Venditti, Daniele Catone, Patrick O'Keeffe, Alessandra Paladini, Francesco Toschi, Stefano Turchini, Fabio Sciubba, Giovanna Testa, Chiara Battocchio, Laura Carlini, Remo Proietti Zaccaria, Elena Magnano, Igor Pis, Lorenzo Avaldi
Gold nanoparticles with an average diameter of 10 nm, functionalized by the dye molecule rhodamine B isothiocyanate, have been synthesized. The resulting material has been extensively characterized both chemically, to investigate the bonding between the dye molecules and the nanoparticles, and physically, to understand the details of the aggregation induced by interaction between dye molecules on different nanoparticles. The plasmonic response of the system has been further characterized by measurement and theoretical simulation of the static UV-Vis extinction spectra of the aggregates produced following different synthesis procedures...
November 4, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29132109/highly-enhanced-adsorption-performance-of-u-vi-by-non-thermal-plasma-modified-magnetic-fe3o4-nanoparticles
#11
Shengxia Duan, Xuetao Xu, Xia Liu, Yanan Wang, Tasawar Hayat, Ahmed Alsaedi, Yuedong Meng, Jiaxing Li
In this study, magnetic Fe3O4 nanoparticles (MNP) modified with O-phosphorylethanolamine (O-PEA) were successfully prepared by non-thermal plasma induced method with different treatment times. The raw and modified MNP were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), Fourier transform infrared spectrophotometer (FT-IR), and vibration sample magnetometer (VSM). The modified MNP samples show higher adsorption capacity for U(VI) removal and longer treatment time results in higher adsorption capacity and efficiency...
November 3, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29128619/preparation-of-porous-carbon-spheres-from-2-keto-l-gulonic-acid-mother-liquor-by-oxidation-and-activation-for-electric-double-layer-capacitor-application
#12
Zhi-Qiang Hao, Jing-Pei Cao, Xiao-Yan Zhao, Yan Wu, Jun-Sheng Zhu, Ya-Li Dang, Qi-Qi Zhuang, Xian-Yong Wei
A novel strategy is proposed for the increase of specific surface area (SSA) of porous carbon sphere (PCS) by oxidation and activation. 2-keto-l-gulonic acid mother liquor (GAML) as a high-pollution waste has a relatively high value of reutilization. For its high value-added utilization, GAML is used as the precursor for preparation of PCS as carbon-based electrode materials for electric double-layer capacitor. PCS is prepared by hydrothermal carbonization, carbonization and KOH activation, and Fe(NO3)3 9H2O is used as an oxidizing agent during carbonization...
November 3, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29128617/benign-preparation-of-aqueous-core-poly-lactic-co-glycolic-acid-plga-microcapsules
#13
Toshiyuki Nomura, Alexander F Routh
Poly lactic-co-glycolic acid (PLGA) has attracted considerable attention as a polymer for drug delivery carriers. However, the hydrophobic property of PLGA often leads to the use of harmful organic solvents and poor encapsulation efficiency of hydrophilic materials. To our knowledge, a preparation method of aqueous core PLGA microcapsules without using harmful organic solvents has not been proposed. In this study, we attempted to establish an encapsulation technique of hydrophilic materials in aqueous core biodegradable and biocompatible PLGA microcapsules using vegetable oil as a continuous phase...
November 3, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29107919/synthesis-and-characterization-of-alginate-beads-encapsulated-zinc-oxide-nanoparticles-for-bacteria-disinfection-in-water
#14
Sarah Constance Motshekga, Suprakas Sinha Ray, Arjun Maity
The use of polymer nanocomposites as novel materials for water remediation has emerged as a promising alternative for disinfection of bacteria contaminated water. Sodium alginate, a natural biopolymer has been investigated in this study by encapsulating antimicrobial zinc oxide nanoparticles supported bentonite. The confirmation of the alginate nanocomposites was done by use of TEM, SEM-EDS and XRD. The antimicrobial activity of the alginate nanocomposites was investigated by batch studies using surface water and synthetic bacteria contaminated water containing Staphylococcus aureus...
November 3, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29132106/silver-oxide-nanoparticles-embedded-silk-fibroin-spuns-microwave-mediated-preparation-characterization-and-their-synergistic-wound-healing-and-anti-bacterial-activity
#15
Punuri Jayasekhar Babu, Mukesh Doble, Ashok M Raichur
The synergistic wound healing and antibacterial activity of silver oxide nanoparticles embedded silk fibroin (Ag2O-SF) spuns is reported here. UV-Vis spectro photometric analysis of these spuns showed the surface plasmon resonance (SPR) confirming the formation of the silver oxide nanoparticles (Ag2O NPs) on the surface of the silk fibroin (SF). Scanning electron microscope (SEM) and Differential scanning calorimetry (DSC) also confirmed the presence of Ag2O NPs on surface of SF. X-ray diffraction (XRD) analysis revealed the crystalline nature of both SF and Ag2O-SF...
November 2, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29132103/fixed-bed-column-studies-of-total-organic-carbon-removal-from-industrial-wastewater-by-use-of-diatomite-decorated-with-polyethylenimine-functionalized-pyroxene-nanoparticles
#16
Afif Hethnawi, Abdallah D Manasrah, Gerardo Vitale, Nashaat N Nassar
In this study, a fixed-bed column adsorption process was employed to remove organic pollutants from a real industrial wastewater effluent using polyethylenimine-functionalized pyroxene nanoparticles (PEI-PY) embedded into Diatomite at very low mass percentage. Various dynamic parameters (e.g., inlet concentration, inlet flow rate, bed height, and PEI-nanoparticle concentration in Diatomite, (%nps)) were investigated to determine the breakthrough behavior. The obtained breakthrough curves were fit with a convection-dispersion model to determine the characteristic parameters based on mass transfer phenomena...
November 2, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29121611/colloidal-design-of-plasmonic-sensors-based-on-surface-enhanced-raman-scattering
#17
Cyrille Hamon, Luis M Liz-Marzán
This feature article focuses on the use of colloid chemistry to engineer metallic nanostructures toward application in surface enhanced Raman scattering (SERS) sensing, in particular for 'real-life' applications, where the analyte may be present in complex mixtures. We present a broad summary of the field, including recent advances that have been developed during the past 10 years. Real-life applications require a rational design and we aimed at identifying the key elements involved in it. The discussion is centered around colloidal plasmonic nanoparticles and therefore we start from the library of morphologies that have been reported in the literature...
November 2, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29121610/hydrogen-bond-assisted-synthesis-of-mos2-reduced-graphene-oxide-composite-with-excellent-electrochemical-performances-for-lithium-and-sodium-storage
#18
Weiwei Qin, Yuan Li, Yongqiang Teng, Tao Qin
MoS2/reduced graphene oxide composites (MoS2/rGO) were successfully prepared by a designed tris(hydroxymethyl)methyl aminomethane (named THAM)-assisted hydrothermal method, which involves the modification of THAM on the surfaces of graphene oxide via hydrogen bonds and then the adsorption of MoO4(2-) on the decorated surfaces due to the electrostatic attraction. The three-dimensional framework of interconnected rGO nanosheets provides good electronic conductivity and facile strain release during the electrochemical reaction, thus enhancing the overall performance of the MoS2-based electrode...
November 2, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29145016/thermal-effect-on-the-degradation-of-hiapp20-29-fibrils
#19
H X Zhang, Lei Liu, Jie Wang, Christian Bortolini, Mingdong Dong
Uncontrolled misfolding of proteins resulting in the formation of amyloid deposits is associated with over 40 types of diseases, for instance, type-2 diabetes. The human Islet amyloid polypeptide (hIAPP) amyloid formation is thought to be the cause of type-2 diabetes occurrence. A possible strategy to the current challenge of reducing the toxicity of its aggregates to pancreatic β-cell is the discovery of an efficient way to degrading amyloid deposits. In this work, hIAPP20-29, a core fibrillating fragment of hIAPP, was selected as model system to explore the thermal effect at different temperature on the degradation of hIAPP20-29 mature fibrils...
October 31, 2017: Journal of Colloid and Interface Science
https://www.readbyqxmd.com/read/29127825/surfactant-structural-effects-on-mediated-electrocatalytic-dechlorination-links-between-the-micellar-enhancement-of-dechlorination-reactions-and-micellar-properties
#20
K Chandrasekara Pillai, G Muthuraman, Il-Shik Moon
Electrocatalytic dechlorination mediated by micelle-solubilized electrocatalysts has attracted considerable current interest for pollutant degradation. Aggregation in micellar assemblies and their interactions with the additives in solution are affected by the surfactant structure. By choosing appropriate surfactant molecules, the system properties may be altered to achieve enhanced dechlorination efficiency. Cetyltrimethylammonium bromide-based surfactants with different hydrocarbon lengths and headgroup structures were studied for their structural effects on [Co(I)(bipyridine)3](+)-mediated dechlorination reactions...
October 31, 2017: Journal of Colloid and Interface Science
journal
journal
21294
1
2
Fetch more papers »
Fetching more papers... Fetching...
Read by QxMD. Sign in or create an account to discover new knowledge that matter to you.
Remove bar
Read by QxMD icon Read
×

Search Tips

Use Boolean operators: AND/OR

diabetic AND foot
diabetes OR diabetic

Exclude a word using the 'minus' sign

Virchow -triad

Use Parentheses

water AND (cup OR glass)

Add an asterisk (*) at end of a word to include word stems

Neuro* will search for Neurology, Neuroscientist, Neurological, and so on

Use quotes to search for an exact phrase

"primary prevention of cancer"
(heart or cardiac or cardio*) AND arrest -"American Heart Association"